PROGRAM: T-COFFEE Version_13.39.0.d675aed (2019-08-06 13:13:52 - Revision ea757e1 - Build 453) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [1] EXPRESSO -setenv S [0] 0 -export S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [1] EXPRESSO -in S [0] -seq S [1] /tmp/three.pfa -aln S [0] -method_limits S [0] -method S [1] sap_pair -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [0] aln html -len D [0] 0 -infile R_F [0] -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -ulimit D [0] -1 -maxnseq D [0] -1 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -color_mode S [0] new -aln_line_length D [0] 0 -evaluate_mode S [0] triplet -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_trim D [20] 20 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniref50 -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -print_cache FL [0] 0 -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -et_mode S [0] et -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [0] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 1 -thread D [0] 1 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -proxy S [0] unset -email S [1] mathog@caltech.edu -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -display D [0] 100 INPUT FILES Input File (S) /tmp/three.pfa Format fasta_seq Input File (M) sap_pair Identify Master Sequences [no]: Master Sequences Identified Looking For Sequence Templates: Template Type: [EXPRESSO] Mode Or File: [EXPRESSO] [Start ! Process: >three [EBI/blast/pdb][COMPUTE CACHE] 19541 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19541 -- WARNING: Cannot find pdb_entry_type.txt; 3CHNC is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19541 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19541 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19541 -- WARNING: Cannot find unrealeased.xml; 3CHNC is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19541 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19541 -- WARNING: Cannot find pdb_entry_type.txt; 3CHNC is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19541 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19541 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19541 -- WARNING: Cannot find unrealeased.xml; 3CHNC is assumed to be released; ************************************************************************************************* **3CHNC [PDB NOT RELEASED or WITHDRAWN] 19548 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19548 -- WARNING: Cannot find pdb_entry_type.txt; 3CHND is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19548 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19548 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19548 -- WARNING: Cannot find unrealeased.xml; 3CHND is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19548 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19548 -- WARNING: Cannot find pdb_entry_type.txt; 3CHND is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19548 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19548 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19548 -- WARNING: Cannot find unrealeased.xml; 3CHND is assumed to be released; ************************************************************************************************* **3CHND [PDB NOT RELEASED or WITHDRAWN] 19555 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19555 -- WARNING: Cannot find pdb_entry_type.txt; 3CHNB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19555 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19555 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19555 -- WARNING: Cannot find unrealeased.xml; 3CHNB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19555 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19555 -- WARNING: Cannot find pdb_entry_type.txt; 3CHNB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19555 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19555 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19555 -- WARNING: Cannot find unrealeased.xml; 3CHNB is assumed to be released; ************************************************************************************************* **3CHNB [PDB NOT RELEASED or WITHDRAWN] 19562 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19562 -- WARNING: Cannot find pdb_entry_type.txt; 3CHNA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19562 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19562 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19562 -- WARNING: Cannot find unrealeased.xml; 3CHNA is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19562 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19562 -- WARNING: Cannot find pdb_entry_type.txt; 3CHNA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19562 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19562 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19562 -- WARNING: Cannot find unrealeased.xml; 3CHNA is assumed to be released; ************************************************************************************************* **3CHNA [PDB NOT RELEASED or WITHDRAWN] 19569 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19569 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJD is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19569 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19569 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19569 -- WARNING: Cannot find unrealeased.xml; 2QTJD is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19569 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19569 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJD is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19569 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19569 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19569 -- WARNING: Cannot find unrealeased.xml; 2QTJD is assumed to be released; ************************************************************************************************* **2QTJD [PDB NOT RELEASED or WITHDRAWN] 19576 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19576 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJC is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19576 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19576 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19576 -- WARNING: Cannot find unrealeased.xml; 2QTJC is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19576 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19576 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJC is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19576 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19576 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19576 -- WARNING: Cannot find unrealeased.xml; 2QTJC is assumed to be released; ************************************************************************************************* **2QTJC [PDB NOT RELEASED or WITHDRAWN] 19583 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19583 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19583 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19583 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19583 -- WARNING: Cannot find unrealeased.xml; 2QTJB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19583 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19583 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19583 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19583 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19583 -- WARNING: Cannot find unrealeased.xml; 2QTJB is assumed to be released; ************************************************************************************************* **2QTJB [PDB NOT RELEASED or WITHDRAWN] 19590 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19590 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19590 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19590 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19590 -- WARNING: Cannot find unrealeased.xml; 2QTJA is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19590 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19590 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19590 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19590 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19590 -- WARNING: Cannot find unrealeased.xml; 2QTJA is assumed to be released; ************************************************************************************************* **2QTJA [PDB NOT RELEASED or WITHDRAWN] 19597 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19597 -- WARNING: Cannot find pdb_entry_type.txt; 2ESGB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19597 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19597 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19597 -- WARNING: Cannot find unrealeased.xml; 2ESGB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19597 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19597 -- WARNING: Cannot find pdb_entry_type.txt; 2ESGB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19597 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19597 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19597 -- WARNING: Cannot find unrealeased.xml; 2ESGB is assumed to be released; ************************************************************************************************* **2ESGB [PDB NOT RELEASED or WITHDRAWN] 19604 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19604 -- WARNING: Cannot find pdb_entry_type.txt; 2ESGA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19604 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19604 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19604 -- WARNING: Cannot find unrealeased.xml; 2ESGA is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19604 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19604 -- WARNING: Cannot find pdb_entry_type.txt; 2ESGA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19604 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19604 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19604 -- WARNING: Cannot find unrealeased.xml; 2ESGA is assumed to be released; ************************************************************************************************* **2ESGA [PDB NOT RELEASED or WITHDRAWN] 19611 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19611 -- WARNING: Cannot find pdb_entry_type.txt; 1IGAB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19611 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19611 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19611 -- WARNING: Cannot find unrealeased.xml; 1IGAB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19611 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19611 -- WARNING: Cannot find pdb_entry_type.txt; 1IGAB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19611 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19611 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19611 -- WARNING: Cannot find unrealeased.xml; 1IGAB is assumed to be released; ************************************************************************************************* **1IGAB [PDB NOT RELEASED or WITHDRAWN] 19618 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19618 -- WARNING: Cannot find pdb_entry_type.txt; 1IGAA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19618 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19618 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19618 -- WARNING: Cannot find unrealeased.xml; 1IGAA is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19618 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19618 -- WARNING: Cannot find pdb_entry_type.txt; 1IGAA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19618 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19618 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19618 -- WARNING: Cannot find unrealeased.xml; 1IGAA is assumed to be released; ************************************************************************************************* **1IGAA [PDB NOT RELEASED or WITHDRAWN] 19625 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19625 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9D is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19625 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19625 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19625 -- WARNING: Cannot find unrealeased.xml; 3CM9D is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19625 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19625 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9D is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19625 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19625 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19625 -- WARNING: Cannot find unrealeased.xml; 3CM9D is assumed to be released; ************************************************************************************************* **3CM9D [PDB NOT RELEASED or WITHDRAWN] 19632 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19632 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9C is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19632 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19632 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19632 -- WARNING: Cannot find unrealeased.xml; 3CM9C is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19632 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19632 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9C is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19632 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19632 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19632 -- WARNING: Cannot find unrealeased.xml; 3CM9C is assumed to be released; ************************************************************************************************* **3CM9C [PDB NOT RELEASED or WITHDRAWN] 19639 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19639 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9B is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19639 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19639 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19639 -- WARNING: Cannot find unrealeased.xml; 3CM9B is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19639 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19639 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9B is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19639 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19639 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19639 -- WARNING: Cannot find unrealeased.xml; 3CM9B is assumed to be released; ************************************************************************************************* **3CM9B [PDB NOT RELEASED or WITHDRAWN] 19646 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19646 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9A is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19646 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19646 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19646 -- WARNING: Cannot find unrealeased.xml; 3CM9A is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19646 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19646 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9A is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19646 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19646 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19646 -- WARNING: Cannot find unrealeased.xml; 3CM9A is assumed to be released; ************************************************************************************************* **3CM9A [PDB NOT RELEASED or WITHDRAWN] 19653 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19653 -- WARNING: Cannot find pdb_entry_type.txt; 1R70D is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19653 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19653 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19653 -- WARNING: Cannot find unrealeased.xml; 1R70D is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19653 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19653 -- WARNING: Cannot find pdb_entry_type.txt; 1R70D is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19653 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19653 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19653 -- WARNING: Cannot find unrealeased.xml; 1R70D is assumed to be released; ************************************************************************************************* **1R70D [PDB NOT RELEASED or WITHDRAWN] 19660 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19660 -- WARNING: Cannot find pdb_entry_type.txt; 1R70B is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19660 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19660 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19660 -- WARNING: Cannot find unrealeased.xml; 1R70B is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19660 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19660 -- WARNING: Cannot find pdb_entry_type.txt; 1R70B is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19660 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19660 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19660 -- WARNING: Cannot find unrealeased.xml; 1R70B is assumed to be released; ************************************************************************************************* **1R70B [PDB NOT RELEASED or WITHDRAWN] 19667 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19667 -- WARNING: Cannot find pdb_entry_type.txt; 2QEJB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19667 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19667 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19667 -- WARNING: Cannot find unrealeased.xml; 2QEJB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19667 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19667 -- WARNING: Cannot find pdb_entry_type.txt; 2QEJB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19667 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19667 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19667 -- WARNING: Cannot find unrealeased.xml; 2QEJB is assumed to be released; ************************************************************************************************* **2QEJB [PDB NOT RELEASED or WITHDRAWN] 19674 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19674 -- WARNING: Cannot find pdb_entry_type.txt; 2QEJA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19674 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19674 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19674 -- WARNING: Cannot find unrealeased.xml; 2QEJA is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19674 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19674 -- WARNING: Cannot find pdb_entry_type.txt; 2QEJA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19674 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19674 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19674 -- WARNING: Cannot find unrealeased.xml; 2QEJA is assumed to be released; ************************************************************************************************* **2QEJA [PDB NOT RELEASED or WITHDRAWN] 19681 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19681 -- WARNING: Cannot find pdb_entry_type.txt; 1OW0B is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19681 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19681 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19681 -- WARNING: Cannot find unrealeased.xml; 1OW0B is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19681 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19681 -- WARNING: Cannot find pdb_entry_type.txt; 1OW0B is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19681 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19681 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19681 -- WARNING: Cannot find unrealeased.xml; 1OW0B is assumed to be released; ************************************************************************************************* **1OW0B [PDB NOT RELEASED or WITHDRAWN] 19688 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19688 -- WARNING: Cannot find pdb_entry_type.txt; 1OW0A is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19688 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19688 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19688 -- WARNING: Cannot find unrealeased.xml; 1OW0A is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19688 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19688 -- WARNING: Cannot find pdb_entry_type.txt; 1OW0A is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19688 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19688 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19688 -- WARNING: Cannot find unrealeased.xml; 1OW0A is assumed to be released; ************************************************************************************************* **1OW0A [PDB NOT RELEASED or WITHDRAWN] 19695 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19695 -- WARNING: Cannot find pdb_entry_type.txt; 6D4MB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19695 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19695 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19695 -- WARNING: Cannot find unrealeased.xml; 6D4MB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19695 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19695 -- WARNING: Cannot find pdb_entry_type.txt; 6D4MB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19695 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19695 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19695 -- WARNING: Cannot find unrealeased.xml; 6D4MB is assumed to be released; ************************************************************************************************* **6D4MB [PDB NOT RELEASED or WITHDRAWN] 19702 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19702 -- WARNING: Cannot find pdb_entry_type.txt; 6D4MA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19702 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19702 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19702 -- WARNING: Cannot find unrealeased.xml; 6D4MA is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19702 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19702 -- WARNING: Cannot find pdb_entry_type.txt; 6D4MA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19702 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19702 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19702 -- WARNING: Cannot find unrealeased.xml; 6D4MA is assumed to be released; ************************************************************************************************* **6D4MA [PDB NOT RELEASED or WITHDRAWN] 19709 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19709 -- WARNING: Cannot find pdb_entry_type.txt; 6G1EB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19709 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19709 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19709 -- WARNING: Cannot find unrealeased.xml; 6G1EB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19709 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19709 -- WARNING: Cannot find pdb_entry_type.txt; 6G1EB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19709 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19709 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19709 -- WARNING: Cannot find unrealeased.xml; 6G1EB is assumed to be released; ************************************************************************************************* **6G1EB [PDB NOT RELEASED or WITHDRAWN] 19716 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19716 -- WARNING: Cannot find pdb_entry_type.txt; 5M3VB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19716 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19716 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19716 -- WARNING: Cannot find unrealeased.xml; 5M3VB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19716 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19716 -- WARNING: Cannot find pdb_entry_type.txt; 5M3VB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19716 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19716 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19716 -- WARNING: Cannot find unrealeased.xml; 5M3VB is assumed to be released; ************************************************************************************************* **5M3VB [PDB NOT RELEASED or WITHDRAWN] >three No Template Selected ! Process: >one [EBI/blast/pdb][COMPUTE CACHE] 19749 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19749 -- WARNING: Cannot find pdb_entry_type.txt; 3CHNC is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19749 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19749 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19749 -- WARNING: Cannot find unrealeased.xml; 3CHNC is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19749 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19749 -- WARNING: Cannot find pdb_entry_type.txt; 3CHNC is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19749 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19749 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19749 -- WARNING: Cannot find unrealeased.xml; 3CHNC is assumed to be released; ************************************************************************************************* **3CHNC [PDB NOT RELEASED or WITHDRAWN] 19756 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19756 -- WARNING: Cannot find pdb_entry_type.txt; 3CHND is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19756 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19756 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19756 -- WARNING: Cannot find unrealeased.xml; 3CHND is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19756 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19756 -- WARNING: Cannot find pdb_entry_type.txt; 3CHND is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19756 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19756 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19756 -- WARNING: Cannot find unrealeased.xml; 3CHND is assumed to be released; ************************************************************************************************* **3CHND [PDB NOT RELEASED or WITHDRAWN] 19763 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19763 -- WARNING: Cannot find pdb_entry_type.txt; 3CHNB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19763 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19763 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19763 -- WARNING: Cannot find unrealeased.xml; 3CHNB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19763 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19763 -- WARNING: Cannot find pdb_entry_type.txt; 3CHNB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19763 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19763 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19763 -- WARNING: Cannot find unrealeased.xml; 3CHNB is assumed to be released; ************************************************************************************************* **3CHNB [PDB NOT RELEASED or WITHDRAWN] 19770 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19770 -- WARNING: Cannot find pdb_entry_type.txt; 3CHNA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19770 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19770 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19770 -- WARNING: Cannot find unrealeased.xml; 3CHNA is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19770 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19770 -- WARNING: Cannot find pdb_entry_type.txt; 3CHNA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19770 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19770 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19770 -- WARNING: Cannot find unrealeased.xml; 3CHNA is assumed to be released; ************************************************************************************************* **3CHNA [PDB NOT RELEASED or WITHDRAWN] 19777 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19777 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJD is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19777 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19777 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19777 -- WARNING: Cannot find unrealeased.xml; 2QTJD is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19777 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19777 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJD is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19777 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19777 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19777 -- WARNING: Cannot find unrealeased.xml; 2QTJD is assumed to be released; ************************************************************************************************* **2QTJD [PDB NOT RELEASED or WITHDRAWN] 19784 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19784 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJC is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19784 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19784 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19784 -- WARNING: Cannot find unrealeased.xml; 2QTJC is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19784 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19784 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJC is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19784 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19784 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19784 -- WARNING: Cannot find unrealeased.xml; 2QTJC is assumed to be released; ************************************************************************************************* **2QTJC [PDB NOT RELEASED or WITHDRAWN] 19791 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19791 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19791 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19791 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19791 -- WARNING: Cannot find unrealeased.xml; 2QTJB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19791 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19791 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19791 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19791 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19791 -- WARNING: Cannot find unrealeased.xml; 2QTJB is assumed to be released; ************************************************************************************************* **2QTJB [PDB NOT RELEASED or WITHDRAWN] 19798 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19798 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19798 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19798 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19798 -- WARNING: Cannot find unrealeased.xml; 2QTJA is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19798 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19798 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19798 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19798 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19798 -- WARNING: Cannot find unrealeased.xml; 2QTJA is assumed to be released; ************************************************************************************************* **2QTJA [PDB NOT RELEASED or WITHDRAWN] 19805 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19805 -- WARNING: Cannot find pdb_entry_type.txt; 2ESGB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19805 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19805 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19805 -- WARNING: Cannot find unrealeased.xml; 2ESGB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19805 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19805 -- WARNING: Cannot find pdb_entry_type.txt; 2ESGB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19805 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19805 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19805 -- WARNING: Cannot find unrealeased.xml; 2ESGB is assumed to be released; ************************************************************************************************* **2ESGB [PDB NOT RELEASED or WITHDRAWN] 19812 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19812 -- WARNING: Cannot find pdb_entry_type.txt; 2ESGA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19812 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19812 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19812 -- WARNING: Cannot find unrealeased.xml; 2ESGA is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19812 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19812 -- WARNING: Cannot find pdb_entry_type.txt; 2ESGA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19812 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19812 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19812 -- WARNING: Cannot find unrealeased.xml; 2ESGA is assumed to be released; ************************************************************************************************* **2ESGA [PDB NOT RELEASED or WITHDRAWN] 19819 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19819 -- WARNING: Cannot find pdb_entry_type.txt; 1IGAB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19819 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19819 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19819 -- WARNING: Cannot find unrealeased.xml; 1IGAB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19819 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19819 -- WARNING: Cannot find pdb_entry_type.txt; 1IGAB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19819 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19819 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19819 -- WARNING: Cannot find unrealeased.xml; 1IGAB is assumed to be released; ************************************************************************************************* **1IGAB [PDB NOT RELEASED or WITHDRAWN] 19826 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19826 -- WARNING: Cannot find pdb_entry_type.txt; 1IGAA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19826 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19826 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19826 -- WARNING: Cannot find unrealeased.xml; 1IGAA is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19826 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19826 -- WARNING: Cannot find pdb_entry_type.txt; 1IGAA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19826 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19826 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19826 -- WARNING: Cannot find unrealeased.xml; 1IGAA is assumed to be released; ************************************************************************************************* **1IGAA [PDB NOT RELEASED or WITHDRAWN] 19833 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19833 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9D is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19833 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19833 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19833 -- WARNING: Cannot find unrealeased.xml; 3CM9D is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19833 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19833 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9D is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19833 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19833 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19833 -- WARNING: Cannot find unrealeased.xml; 3CM9D is assumed to be released; ************************************************************************************************* **3CM9D [PDB NOT RELEASED or WITHDRAWN] 19840 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19840 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9C is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19840 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19840 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19840 -- WARNING: Cannot find unrealeased.xml; 3CM9C is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19840 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19840 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9C is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19840 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19840 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19840 -- WARNING: Cannot find unrealeased.xml; 3CM9C is assumed to be released; ************************************************************************************************* **3CM9C [PDB NOT RELEASED or WITHDRAWN] 19847 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19847 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9B is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19847 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19847 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19847 -- WARNING: Cannot find unrealeased.xml; 3CM9B is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19847 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19847 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9B is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19847 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19847 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19847 -- WARNING: Cannot find unrealeased.xml; 3CM9B is assumed to be released; ************************************************************************************************* **3CM9B [PDB NOT RELEASED or WITHDRAWN] 19854 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19854 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9A is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19854 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19854 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19854 -- WARNING: Cannot find unrealeased.xml; 3CM9A is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19854 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19854 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9A is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19854 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19854 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19854 -- WARNING: Cannot find unrealeased.xml; 3CM9A is assumed to be released; ************************************************************************************************* **3CM9A [PDB NOT RELEASED or WITHDRAWN] 19861 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19861 -- WARNING: Cannot find pdb_entry_type.txt; 1R70D is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19861 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19861 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19861 -- WARNING: Cannot find unrealeased.xml; 1R70D is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19861 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19861 -- WARNING: Cannot find pdb_entry_type.txt; 1R70D is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19861 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19861 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19861 -- WARNING: Cannot find unrealeased.xml; 1R70D is assumed to be released; ************************************************************************************************* **1R70D [PDB NOT RELEASED or WITHDRAWN] 19868 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19868 -- WARNING: Cannot find pdb_entry_type.txt; 1R70B is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19868 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19868 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19868 -- WARNING: Cannot find unrealeased.xml; 1R70B is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19868 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19868 -- WARNING: Cannot find pdb_entry_type.txt; 1R70B is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19868 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19868 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19868 -- WARNING: Cannot find unrealeased.xml; 1R70B is assumed to be released; ************************************************************************************************* **1R70B [PDB NOT RELEASED or WITHDRAWN] 19875 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19875 -- WARNING: Cannot find pdb_entry_type.txt; 2QEJB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19875 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19875 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19875 -- WARNING: Cannot find unrealeased.xml; 2QEJB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19875 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19875 -- WARNING: Cannot find pdb_entry_type.txt; 2QEJB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19875 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19875 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19875 -- WARNING: Cannot find unrealeased.xml; 2QEJB is assumed to be released; ************************************************************************************************* **2QEJB [PDB NOT RELEASED or WITHDRAWN] 19882 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19882 -- WARNING: Cannot find pdb_entry_type.txt; 2QEJA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19882 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19882 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19882 -- WARNING: Cannot find unrealeased.xml; 2QEJA is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19882 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19882 -- WARNING: Cannot find pdb_entry_type.txt; 2QEJA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19882 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19882 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19882 -- WARNING: Cannot find unrealeased.xml; 2QEJA is assumed to be released; ************************************************************************************************* **2QEJA [PDB NOT RELEASED or WITHDRAWN] 19889 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19889 -- WARNING: Cannot find pdb_entry_type.txt; 1OW0B is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19889 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19889 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19889 -- WARNING: Cannot find unrealeased.xml; 1OW0B is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19889 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19889 -- WARNING: Cannot find pdb_entry_type.txt; 1OW0B is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19889 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19889 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19889 -- WARNING: Cannot find unrealeased.xml; 1OW0B is assumed to be released; ************************************************************************************************* **1OW0B [PDB NOT RELEASED or WITHDRAWN] 19896 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19896 -- WARNING: Cannot find pdb_entry_type.txt; 1OW0A is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19896 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19896 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19896 -- WARNING: Cannot find unrealeased.xml; 1OW0A is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19896 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19896 -- WARNING: Cannot find pdb_entry_type.txt; 1OW0A is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19896 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19896 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19896 -- WARNING: Cannot find unrealeased.xml; 1OW0A is assumed to be released; ************************************************************************************************* **1OW0A [PDB NOT RELEASED or WITHDRAWN] 19903 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19903 -- WARNING: Cannot find pdb_entry_type.txt; 6D4MB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19903 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19903 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19903 -- WARNING: Cannot find unrealeased.xml; 6D4MB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19903 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19903 -- WARNING: Cannot find pdb_entry_type.txt; 6D4MB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19903 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19903 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19903 -- WARNING: Cannot find unrealeased.xml; 6D4MB is assumed to be released; ************************************************************************************************* **6D4MB [PDB NOT RELEASED or WITHDRAWN] 19910 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19910 -- WARNING: Cannot find pdb_entry_type.txt; 6D4MA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19910 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19910 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19910 -- WARNING: Cannot find unrealeased.xml; 6D4MA is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19910 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19910 -- WARNING: Cannot find pdb_entry_type.txt; 6D4MA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19910 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19910 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19910 -- WARNING: Cannot find unrealeased.xml; 6D4MA is assumed to be released; ************************************************************************************************* **6D4MA [PDB NOT RELEASED or WITHDRAWN] 19917 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19917 -- WARNING: Cannot find pdb_entry_type.txt; 6G1EB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19917 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19917 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19917 -- WARNING: Cannot find unrealeased.xml; 6G1EB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19917 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19917 -- WARNING: Cannot find pdb_entry_type.txt; 6G1EB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19917 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19917 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19917 -- WARNING: Cannot find unrealeased.xml; 6G1EB is assumed to be released; ************************************************************************************************* **6G1EB [PDB NOT RELEASED or WITHDRAWN] >one No Template Selected ! Process: >two [EBI/blast/pdb][COMPUTE CACHE] 19952 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19952 -- WARNING: Cannot find pdb_entry_type.txt; 3CHNC is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19952 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19952 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19952 -- WARNING: Cannot find unrealeased.xml; 3CHNC is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19952 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19952 -- WARNING: Cannot find pdb_entry_type.txt; 3CHNC is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19952 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19952 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19952 -- WARNING: Cannot find unrealeased.xml; 3CHNC is assumed to be released; ************************************************************************************************* **3CHNC [PDB NOT RELEASED or WITHDRAWN] 19959 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19959 -- WARNING: Cannot find pdb_entry_type.txt; 3CHND is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19959 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19959 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19959 -- WARNING: Cannot find unrealeased.xml; 3CHND is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19959 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19959 -- WARNING: Cannot find pdb_entry_type.txt; 3CHND is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19959 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19959 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19959 -- WARNING: Cannot find unrealeased.xml; 3CHND is assumed to be released; ************************************************************************************************* **3CHND [PDB NOT RELEASED or WITHDRAWN] 19966 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19966 -- WARNING: Cannot find pdb_entry_type.txt; 3CHNB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19966 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19966 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19966 -- WARNING: Cannot find unrealeased.xml; 3CHNB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19966 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19966 -- WARNING: Cannot find pdb_entry_type.txt; 3CHNB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19966 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19966 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19966 -- WARNING: Cannot find unrealeased.xml; 3CHNB is assumed to be released; ************************************************************************************************* **3CHNB [PDB NOT RELEASED or WITHDRAWN] 19973 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19973 -- WARNING: Cannot find pdb_entry_type.txt; 3CHNA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19973 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19973 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19973 -- WARNING: Cannot find unrealeased.xml; 3CHNA is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19973 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19973 -- WARNING: Cannot find pdb_entry_type.txt; 3CHNA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19973 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19973 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19973 -- WARNING: Cannot find unrealeased.xml; 3CHNA is assumed to be released; ************************************************************************************************* **3CHNA [PDB NOT RELEASED or WITHDRAWN] 19980 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19980 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJD is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19980 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19980 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19980 -- WARNING: Cannot find unrealeased.xml; 2QTJD is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19980 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19980 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJD is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19980 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19980 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19980 -- WARNING: Cannot find unrealeased.xml; 2QTJD is assumed to be released; ************************************************************************************************* **2QTJD [PDB NOT RELEASED or WITHDRAWN] 19987 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19987 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJC is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19987 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19987 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19987 -- WARNING: Cannot find unrealeased.xml; 2QTJC is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19987 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19987 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJC is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19987 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19987 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19987 -- WARNING: Cannot find unrealeased.xml; 2QTJC is assumed to be released; ************************************************************************************************* **2QTJC [PDB NOT RELEASED or WITHDRAWN] 19994 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19994 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19994 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19994 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19994 -- WARNING: Cannot find unrealeased.xml; 2QTJB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 19994 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 19994 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 19994 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19994 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 19994 -- WARNING: Cannot find unrealeased.xml; 2QTJB is assumed to be released; ************************************************************************************************* **2QTJB [PDB NOT RELEASED or WITHDRAWN] 20001 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20001 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20001 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20001 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20001 -- WARNING: Cannot find unrealeased.xml; 2QTJA is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 20001 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20001 -- WARNING: Cannot find pdb_entry_type.txt; 2QTJA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20001 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20001 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20001 -- WARNING: Cannot find unrealeased.xml; 2QTJA is assumed to be released; ************************************************************************************************* **2QTJA [PDB NOT RELEASED or WITHDRAWN] 20008 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20008 -- WARNING: Cannot find pdb_entry_type.txt; 2ESGB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20008 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20008 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20008 -- WARNING: Cannot find unrealeased.xml; 2ESGB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 20008 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20008 -- WARNING: Cannot find pdb_entry_type.txt; 2ESGB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20008 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20008 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20008 -- WARNING: Cannot find unrealeased.xml; 2ESGB is assumed to be released; ************************************************************************************************* **2ESGB [PDB NOT RELEASED or WITHDRAWN] 20016 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20016 -- WARNING: Cannot find pdb_entry_type.txt; 2ESGA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20016 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20016 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20016 -- WARNING: Cannot find unrealeased.xml; 2ESGA is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 20016 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20016 -- WARNING: Cannot find pdb_entry_type.txt; 2ESGA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20016 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20016 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20016 -- WARNING: Cannot find unrealeased.xml; 2ESGA is assumed to be released; ************************************************************************************************* **2ESGA [PDB NOT RELEASED or WITHDRAWN] 20023 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20023 -- WARNING: Cannot find pdb_entry_type.txt; 1IGAB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20023 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20023 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20023 -- WARNING: Cannot find unrealeased.xml; 1IGAB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 20023 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20023 -- WARNING: Cannot find pdb_entry_type.txt; 1IGAB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20023 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20023 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20023 -- WARNING: Cannot find unrealeased.xml; 1IGAB is assumed to be released; ************************************************************************************************* **1IGAB [PDB NOT RELEASED or WITHDRAWN] 20030 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20030 -- WARNING: Cannot find pdb_entry_type.txt; 1IGAA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20030 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20030 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20030 -- WARNING: Cannot find unrealeased.xml; 1IGAA is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 20030 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20030 -- WARNING: Cannot find pdb_entry_type.txt; 1IGAA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20030 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20030 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20030 -- WARNING: Cannot find unrealeased.xml; 1IGAA is assumed to be released; ************************************************************************************************* **1IGAA [PDB NOT RELEASED or WITHDRAWN] 20037 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20037 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9D is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20037 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20037 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20037 -- WARNING: Cannot find unrealeased.xml; 3CM9D is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 20037 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20037 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9D is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20037 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20037 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20037 -- WARNING: Cannot find unrealeased.xml; 3CM9D is assumed to be released; ************************************************************************************************* **3CM9D [PDB NOT RELEASED or WITHDRAWN] 20044 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20044 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9C is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20044 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20044 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20044 -- WARNING: Cannot find unrealeased.xml; 3CM9C is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 20044 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20044 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9C is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20044 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20044 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20044 -- WARNING: Cannot find unrealeased.xml; 3CM9C is assumed to be released; ************************************************************************************************* **3CM9C [PDB NOT RELEASED or WITHDRAWN] 20051 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20051 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9B is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20051 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20051 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20051 -- WARNING: Cannot find unrealeased.xml; 3CM9B is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 20051 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20051 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9B is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20051 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20051 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20051 -- WARNING: Cannot find unrealeased.xml; 3CM9B is assumed to be released; ************************************************************************************************* **3CM9B [PDB NOT RELEASED or WITHDRAWN] 20058 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20058 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9A is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20058 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20058 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20058 -- WARNING: Cannot find unrealeased.xml; 3CM9A is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 20058 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20058 -- WARNING: Cannot find pdb_entry_type.txt; 3CM9A is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20058 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20058 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20058 -- WARNING: Cannot find unrealeased.xml; 3CM9A is assumed to be released; ************************************************************************************************* **3CM9A [PDB NOT RELEASED or WITHDRAWN] 20065 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20065 -- WARNING: Cannot find pdb_entry_type.txt; 1R70D is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20065 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20065 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20065 -- WARNING: Cannot find unrealeased.xml; 1R70D is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 20065 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20065 -- WARNING: Cannot find pdb_entry_type.txt; 1R70D is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20065 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20065 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20065 -- WARNING: Cannot find unrealeased.xml; 1R70D is assumed to be released; ************************************************************************************************* **1R70D [PDB NOT RELEASED or WITHDRAWN] 20072 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20072 -- WARNING: Cannot find pdb_entry_type.txt; 1R70B is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20072 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20072 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20072 -- WARNING: Cannot find unrealeased.xml; 1R70B is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 20072 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20072 -- WARNING: Cannot find pdb_entry_type.txt; 1R70B is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20072 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20072 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20072 -- WARNING: Cannot find unrealeased.xml; 1R70B is assumed to be released; ************************************************************************************************* **1R70B [PDB NOT RELEASED or WITHDRAWN] 20079 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20079 -- WARNING: Cannot find pdb_entry_type.txt; 2QEJB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20079 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20079 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20079 -- WARNING: Cannot find unrealeased.xml; 2QEJB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 20079 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20079 -- WARNING: Cannot find pdb_entry_type.txt; 2QEJB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20079 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20079 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20079 -- WARNING: Cannot find unrealeased.xml; 2QEJB is assumed to be released; ************************************************************************************************* **2QEJB [PDB NOT RELEASED or WITHDRAWN] 20086 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20086 -- WARNING: Cannot find pdb_entry_type.txt; 2QEJA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20086 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20086 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20086 -- WARNING: Cannot find unrealeased.xml; 2QEJA is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 20086 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20086 -- WARNING: Cannot find pdb_entry_type.txt; 2QEJA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20086 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20086 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20086 -- WARNING: Cannot find unrealeased.xml; 2QEJA is assumed to be released; ************************************************************************************************* **2QEJA [PDB NOT RELEASED or WITHDRAWN] 20093 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20093 -- WARNING: Cannot find pdb_entry_type.txt; 1OW0B is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20093 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20093 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20093 -- WARNING: Cannot find unrealeased.xml; 1OW0B is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 20093 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20093 -- WARNING: Cannot find pdb_entry_type.txt; 1OW0B is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20093 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20093 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20093 -- WARNING: Cannot find unrealeased.xml; 1OW0B is assumed to be released; ************************************************************************************************* **1OW0B [PDB NOT RELEASED or WITHDRAWN] 20100 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20100 -- WARNING: Cannot find pdb_entry_type.txt; 1OW0A is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20100 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20100 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20100 -- WARNING: Cannot find unrealeased.xml; 1OW0A is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 20100 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20100 -- WARNING: Cannot find pdb_entry_type.txt; 1OW0A is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20100 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20100 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20100 -- WARNING: Cannot find unrealeased.xml; 1OW0A is assumed to be released; ************************************************************************************************* **1OW0A [PDB NOT RELEASED or WITHDRAWN] 20107 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20107 -- WARNING: Cannot find pdb_entry_type.txt; 6D4MB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20107 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20107 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20107 -- WARNING: Cannot find unrealeased.xml; 6D4MB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 20107 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20107 -- WARNING: Cannot find pdb_entry_type.txt; 6D4MB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20107 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20107 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20107 -- WARNING: Cannot find unrealeased.xml; 6D4MB is assumed to be released; ************************************************************************************************* **6D4MB [PDB NOT RELEASED or WITHDRAWN] 20114 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20114 -- WARNING: Cannot find pdb_entry_type.txt; 6D4MA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20114 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20114 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20114 -- WARNING: Cannot find unrealeased.xml; 6D4MA is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 20114 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20114 -- WARNING: Cannot find pdb_entry_type.txt; 6D4MA is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20114 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20114 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20114 -- WARNING: Cannot find unrealeased.xml; 6D4MA is assumed to be released; ************************************************************************************************* **6D4MA [PDB NOT RELEASED or WITHDRAWN] 20121 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20121 -- WARNING: Cannot find pdb_entry_type.txt; 6G1EB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20121 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20121 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20121 -- WARNING: Cannot find unrealeased.xml; 6G1EB is assumed to be released; ************************************************************************************************* * MESSAGES RECAPITULATION 20121 -- WARNING: PDB_ENTRY_TYPE_FILE must be set to the location of /derived_data/pdb_entry_type.txt when using NO_REMOTE_PDB_DIR=1 20121 -- WARNING: Cannot find pdb_entry_type.txt; 6G1EB is assumed to be valid; add ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_entry_type.txt in /tmp/TCOFFEE/cache/// to automatically check name status 20121 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20121 -- WARNING: UNREALEASED_FILE must be set to the location of your unrealeased.xml file as downloaded from http://www.rcsb.org/pdb/rest/getUnreleased when using NO_REMOTE_PDB_DIR=1 20121 -- WARNING: Cannot find unrealeased.xml; 6G1EB is assumed to be released; ************************************************************************************************* **6G1EB [PDB NOT RELEASED or WITHDRAWN] >two No Template Selected ] Looking For Profile Templates Template Type: [EXPRESSO] Mode Or File: [EXPRESSO] [Start] INPUT SEQUENCES: 3 SEQUENCES [PROTEIN] Input File /tmp/three.pfa Seq one Length 353 type PROTEIN Struct Unchecked Input File /tmp/three.pfa Seq three Length 352 type PROTEIN Struct Unchecked Input File /tmp/three.pfa Seq two Length 349 type PROTEIN Struct Unchecked Multi Core Mode: 1 processors: --- Process Method/Library/Aln S/tmp/three.pfa xxx Retrieved S/tmp/three.pfa --- Process Method/Library/Aln Msap_pair pid 20128 -- Method cannot be applied to [one vs three], proba_pair will be used instead pid 20128 -- Method cannot be applied to [one vs two], proba_pair will be used instead pid 20128 -- Method cannot be applied to [three vs two], proba_pair will be used instead xxx Retrieved Msap_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2130] Library Relaxation: Multi_proc [1] ! [Relax Library][TOT= 3][ 0 %] ! [Relax Library][TOT= 3][ 66 %] ! [Relax Library][TOT= 3][100 %] Relaxation Summary: [2130]--->[2126] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 MAKE GUIDE TREE [MODE=nj][DONE] PROGRESSIVE_ALIGNMENT [Tree Based] Group 1: one Group 2: three Group 3: two #Single Thread Group 4: [Group 2 ( 1 seq)] with [Group 1 ( 1 seq)]-->[Len= 353][PID:19488]#Single Thread Group 5: [Group 3 ( 1 seq)] with [Group 4 ( 2 seq)]-->[Len= 353][PID:19488] ! [Final Evaluation][TOT= 353][ 0 %] ! [Final Evaluation][TOT= 353][ 1 %] ! [Final Evaluation][TOT= 353][ 2 %] ! [Final Evaluation][TOT= 353][ 3 %] ! [Final Evaluation][TOT= 353][ 4 %] ! [Final Evaluation][TOT= 353][ 5 %] ! [Final Evaluation][TOT= 353][ 6 %] ! [Final Evaluation][TOT= 353][ 7 %] ! [Final Evaluation][TOT= 353][ 8 %] ! [Final Evaluation][TOT= 353][ 9 %] ! [Final Evaluation][TOT= 353][ 10 %] ! [Final Evaluation][TOT= 353][ 11 %] ! [Final Evaluation][TOT= 353][ 12 %] ! [Final Evaluation][TOT= 353][ 13 %] ! [Final Evaluation][TOT= 353][ 14 %] ! [Final Evaluation][TOT= 353][ 15 %] ! [Final Evaluation][TOT= 353][ 16 %] ! [Final Evaluation][TOT= 353][ 17 %] ! [Final Evaluation][TOT= 353][ 18 %] ! [Final Evaluation][TOT= 353][ 19 %] ! [Final Evaluation][TOT= 353][ 20 %] ! [Final Evaluation][TOT= 353][ 21 %] ! [Final Evaluation][TOT= 353][ 22 %] ! [Final Evaluation][TOT= 353][ 23 %] ! [Final Evaluation][TOT= 353][ 24 %] ! [Final Evaluation][TOT= 353][ 25 %] ! [Final Evaluation][TOT= 353][ 26 %] ! [Final Evaluation][TOT= 353][ 27 %] ! [Final Evaluation][TOT= 353][ 28 %] ! [Final Evaluation][TOT= 353][ 29 %] ! [Final Evaluation][TOT= 353][ 30 %] ! [Final Evaluation][TOT= 353][ 31 %] ! [Final Evaluation][TOT= 353][ 32 %] ! [Final Evaluation][TOT= 353][ 33 %] ! [Final Evaluation][TOT= 353][ 34 %] ! [Final Evaluation][TOT= 353][ 35 %] ! [Final Evaluation][TOT= 353][ 36 %] ! [Final Evaluation][TOT= 353][ 37 %] ! [Final Evaluation][TOT= 353][ 38 %] ! [Final Evaluation][TOT= 353][ 39 %] ! [Final Evaluation][TOT= 353][ 40 %] ! [Final Evaluation][TOT= 353][ 41 %] ! [Final Evaluation][TOT= 353][ 42 %] ! [Final Evaluation][TOT= 353][ 43 %] ! [Final Evaluation][TOT= 353][ 44 %] ! [Final Evaluation][TOT= 353][ 45 %] ! [Final Evaluation][TOT= 353][ 46 %] ! [Final Evaluation][TOT= 353][ 47 %] ! [Final Evaluation][TOT= 353][ 48 %] ! [Final Evaluation][TOT= 353][ 49 %] ! [Final Evaluation][TOT= 353][ 50 %] ! [Final Evaluation][TOT= 353][ 51 %] ! [Final Evaluation][TOT= 353][ 52 %] ! [Final Evaluation][TOT= 353][ 53 %] ! [Final Evaluation][TOT= 353][ 54 %] ! [Final Evaluation][TOT= 353][ 55 %] ! [Final Evaluation][TOT= 353][ 56 %] ! [Final Evaluation][TOT= 353][ 57 %] ! [Final Evaluation][TOT= 353][ 58 %] ! [Final Evaluation][TOT= 353][ 59 %] ! [Final Evaluation][TOT= 353][ 60 %] ! [Final Evaluation][TOT= 353][ 61 %] ! [Final Evaluation][TOT= 353][ 62 %] ! [Final Evaluation][TOT= 353][ 63 %] ! [Final Evaluation][TOT= 353][ 64 %] ! [Final Evaluation][TOT= 353][ 65 %] ! [Final Evaluation][TOT= 353][ 66 %] ! [Final Evaluation][TOT= 353][ 67 %] ! [Final Evaluation][TOT= 353][ 68 %] ! [Final Evaluation][TOT= 353][ 69 %] ! [Final Evaluation][TOT= 353][ 70 %] ! [Final Evaluation][TOT= 353][ 71 %] ! [Final Evaluation][TOT= 353][ 72 %] ! [Final Evaluation][TOT= 353][ 73 %] ! [Final Evaluation][TOT= 353][ 74 %] ! [Final Evaluation][TOT= 353][ 75 %] ! [Final Evaluation][TOT= 353][ 76 %] ! [Final Evaluation][TOT= 353][ 77 %] ! [Final Evaluation][TOT= 353][ 78 %] ! [Final Evaluation][TOT= 353][ 79 %] ! [Final Evaluation][TOT= 353][ 80 %] ! [Final Evaluation][TOT= 353][ 81 %] ! [Final Evaluation][TOT= 353][ 82 %] ! [Final Evaluation][TOT= 353][ 83 %] ! [Final Evaluation][TOT= 353][ 84 %] ! [Final Evaluation][TOT= 353][ 85 %] ! [Final Evaluation][TOT= 353][ 86 %] ! [Final Evaluation][TOT= 353][ 87 %] ! [Final Evaluation][TOT= 353][ 88 %] ! [Final Evaluation][TOT= 353][ 89 %] ! [Final Evaluation][TOT= 353][ 90 %] ! [Final Evaluation][TOT= 353][ 91 %] ! [Final Evaluation][TOT= 353][ 92 %] ! [Final Evaluation][TOT= 353][ 93 %] ! [Final Evaluation][TOT= 353][ 94 %] ! [Final Evaluation][TOT= 353][ 95 %] ! [Final Evaluation][TOT= 353][ 96 %] ! [Final Evaluation][TOT= 353][ 97 %] ! [Final Evaluation][TOT= 353][ 98 %] ! [Final Evaluation][TOT= 353][ 99 %] ! [Final Evaluation][TOT= 353][100 %] OUTPUT RESULTS #### File Type= GUIDE_TREE Format= newick Name= three.dnd #### File Type= MSA Format= aln Name= three.aln #### File Type= MSA Format= html Name= three.html #### File Type= Template_List Format= fasta_seq Name= three_pdb1.template_list # Command Line: t_coffee -mode expresso -seq /tmp/three.pfa -email mathog@caltech.edu [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.993 Mb, Max= 31.002 Mb # Results Produced with T-COFFEE Version_13.39.0.d675aed (2019-08-06 13:13:52 - Revision ea757e1 - Build 453) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ ************************************************************************************************* * MESSAGES RECAPITULATION 20128 -- INFORMATION: Method cannot be applied to [one vs three], proba_pair will be used instead 20128 -- INFORMATION: Method cannot be applied to [one vs two], proba_pair will be used instead 20128 -- INFORMATION: Method cannot be applied to [three vs two], proba_pair will be used instead ************************************************************************************************* #Single Thread CLUSTAL FORMAT for T-COFFEE Version_13.39.0.d675aed [http://www.tcoffee.org] [MODE: expresso ], CPU=0.00 sec, SCORE=99, Nseq=3, Len=353 one ASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTA two ASPTSP--FPLSLCSTQPDGNVVIACLVQGFF--EPLSVTWSESGQGVTA three ASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTA ****** ************************ **************** one RNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVP two RNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVP three RNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVP ************************************************** one CPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLT two CPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLT three CPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLT ************************************************** one GLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGK two GLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGK three GLRDASGVTFTWTPSSGKTTVQGPPERDLCGCYSVSSVLPGCAEPWNHGK ******************::****************************** one TFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTC two TFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTC three TFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTC ************************************************** one LARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRV two LARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRV three LARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRV ************************************************** one AAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDG two AAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDG three AAEDWKKGDTFSCMVGHEALPLAFTQKS-DRLAGKPTHVNVSVVMAEVDG ***************************: ********************* one TCY two TCY three TCY ***