Cure for P! - anyone can play
Cruiser
about his "Cure"
Read it over, and if you have any bright ideas, let us all know.
Cruiser
Uwe Hayek Quotes:
---------------------------------------------
Today however, I pity the microbes, bacterial, viral
or fungal, as it seems my immune systems now crunches
about everything without the help of any antibiotic or
antifungal.
----------------------------------------------
my cure's components can be found in breastmilk
----------------------------------------------
(Regarding a man taking the cure)
The second day, the lump in his neck turns blood red.
I think that is a good sign, since most cancers are
anaerobic, no oxygen rich blood gets to them.
----------------------------------------------
Some twenty people take it for more than a year now,
including myself, and the most annoying side effects
are these painfull rock hard erections that last
almost all night ... :-) Which is not that long, since
4 to 5 hours sleep is enough.
-----------------------------------------------
Suppose some virus depletes a lot of essential
nutrients because your body needs to fight it.
That virus is gone, but you are left with an immune
system without fuel. With then again leads to herpes
to linger, and the medical profession clueless.
Because herpes is the symptom, not the cause.
-----------------------------------------------
You do not decondition by lack of exercise, cfs
*itself*, which I define as a lack of some essential
nutrients, is responsible for the deconditioning.
Once you resuplly, reconditioning is automatic,
without training. At my 46, I climb stairs better
than any age, and with an astounding ease. Almost
without extra breathing.
-----------------------------------------------
But you should avoid eating to much, as excess
equals toxins, and depletes antitoxin reserves. It
is on this mechanism that dieting, paced exercising
and cbt works. Haphazardly, but it works in some
cases, and my theory explains it, as a good theory
should explain *all* ins and outs. Or at least as
much as possible.
------------------------------------------------
Weight gains in Males tend to be caused by low
testosterone levels, another precursor supply problem.
------------------------------------------------
I also tried al sorts of nutritional approaches and
they never worked for me either.
But my system is about replenishing nutrients, not
about a diet, or even taking readily available
supplements. I tried all sorts of the latter too.
And they also made me feel nauseous.
------------------------------------------------
My theory about that is :
every nutrient in excess is a burden, and causes
more harm than relief. So you have to do things
right : only supply the right thing you need.
Because in chemistry : for every molecule you supply
, you must supply another one to react with.
If you need A and B to get rid of toxins, and you
take C,D,E,F,G,H,I,J together with it, in excess, as
usually these "high potency" formulations do, you
are worse of compared to not taking anything.
> I was also quite hopeful about Co.Q10, since it's
> mentioned in a couple of books I've got in the
> CFS section, and have been taking that for over a
> month (200mg a day for the past 2 weeks) but
> haven't noticed any effect from that either.
Been there, done that. The second box still lies
around here one quarter emptied. After one and
quarter box, and still no effect, some 70 tablets it
was I think. And they sold me the ultimate against
fatigue in Sluis, nearby, Rhodiola. No effect
whatsoever.
> The only supplement I've had any lasting success
> on so far is the high potency B-complex
> supplement I'm taking which has significantly
> stabilised my anxiety/panic symptoms. But that's
> it.
Again same thing as the other high potency formulas.
I used to take very strong doses of B6 for bleeding
gums, in my early twenties. When I take one single
high dosage pill of that now, I get sick and my
liver aches.
I never had any bad side effect with my formula.
I always feel better after taking it. And so says
everybody who used it.
-------------------------------------------------
Cold sores disappear rapidly with my formula. After
two days the sore is cured, and then heals in a
week. They do not return. Acne also disappears quickly.
-------------------------------------------------
The cure works best in a no stress, no alcohol, no
coffee, little tabacco, but plenty of relaxation and
detox environment, at least for the first five days.
For the nutrients to build up at least ten days is
needed.
--------------------------------------------------
I plan on guarantying no hart attacks, no strokes, and
no cancer up to 65 years.
--------------------------------------------------
> Lots of nutrition books will tell you how the
> right diet can relieve any number of problems,
> and that may be the case, but the problem is
> often sticking to a special diet long enough and
> strictly enough to tell if it's going to work or
> not. Have you made a truly new discovery.
Yes. I discovered also the reason why some of these
diets work. I stripped the diet down to its
essentials, and in four(4) days you get the
equivalent of a year of macrobiotic dieting.
I just ask you do not drink alcohol or caffeine and
smoke as little as possible for a minimum of five
days. And as little as possible stress. For the
liver to start detoxing in favorable conditions.
---------------------------------------------------
I gave the product to a guy I trusted, I made him
promise not to have it analyzed, and now it turns
out he is having it analyzed, suddenly the 5000
pound cost of this is not a problem.
He will have a hard time getting it analyzed, since
I hid the active ingredients in a lot of other
ingredients.
----------------------------------------------------
Those I can't follow, I do not count.
From those I can follow, and still follow, the
first failure has yet to come in. That means I have
never seen or heard it fail. Everybody reports
dramatic increase of energy levels, several hours of
less sleep requirement, bright and rested mornings.
In the cases of tired or painfull muscles, all
report complete disappearance of symptoms.
I actively follow them up. I do not wait for them to
come to tell me. And I ask people in their
environment too... One also notices : from sloughing
walk to military pace. Skin tone improvements,
brighter eyes, there are so many things that you can
see in an energetic person, things I used to be
jealeous about. A older welder reports he can again
keep up with the young guys, and can keep his job,
they were going to fire him because he got too slow.
And his chronic bronchitis also cleared...as did mine..
The first succes was about a year ago, a 58 year old
truckdriver. He started working again a year ago,
and is still working these long truckdriving hours.
The Welder is six month ago. He took the supplements
for 15 days. A young pub-owner was only a bit tired,
and now drinks 20 beers a day, smokes 2 packs of
sigarettes a day, works 20 hours and sleeps only
two. He is convinced I have a wonder formula, he
caught bronchitis and says that it never went away
that fast, that he knows his own body, and that this
is no upper, it is clean energy, it does not make
your hart pound.
-----------------------------------------------------
My formula cures chronic bronchitis and chronic
fatigue and chronicly sore throats, single or in any
combination. A builder needs bricks and mortar to
build a wall, without them he is useless. And that is
what I do : supply the essentials for the energy
system of the body, and the immune system does the rest.
-----------------------------------------------------
I supply the necessary nutrient for the body to
recover optimally from tiring causes. So I do not
have to worry about the cause. IMO the CFS is due to
a lack of these nutrients, leaving the body no way
to recover, there is no real cause needed to be
tired. The body says "go to sleep, do not burn the
last supplies"
-----------------------------------------------------
> Do you make this product yourself? Is it made in
> an industry-standard clean environment? How can
> you be sure, for example, that it cannot get
> polluted by something?
Did you ever wonder why sugar and salt do not get
polluted by microorganisms?
-----------------------------------------------------
It works like recharging your battery of these
nutrients. Each day is worth 3-4 years of depletion.
-----------------------------------------------------
It is going to work. It would take you 40 years to
deplete your battery again. That is the secret of
the proverbial uncle that smoked and drank till he
was a 100 years old.
-----------------------------------------------------
>>Yes. I discovered also the reason why some of these
>>diets work. I stripped the diet down to its
>>essentials, and in four(4) days you get the
>>equivalent of a year of macrobiotic dieting.
-----------------------------------------------------
It is not only "a detox formula".
-----------------------------------------------------
I listen to these people, they tell me they are
often tired, and they suffer from the typical
cfss/me ailments. When I meet them again they are
raving about the results. Some do not do this, but
then their partners or environment tells me
differently, and I use my good judgment. One notices
someone sloughing or walking straight, or the
disappearrence of facial skin problems.
------------------------------------------------------
> You have not told us any of the ingredients in
> your supplement, you have no proof that it is safe
I have proof that it is safe. Millions have used
them, but not in the right combination or dosage.
-------------------------------------------------------
These nutrients are very essential to life.
Going without them can make you very ill, as you all
experience, and as I experienced almost all of my life.
-------------------------------------------------------
QUOTE
Studies conducted in drug users show that the
decrease in T4 cells precedes a positive antibody
test ("HIV infection") and not vice versa, that is,
the effect precedes the cause. In one study in drug
users "The relative risk for seroconversion among
subjects with one or more CD4 count <500 cells/ll
compared with HIV-negative subjects with all
counts >500 cells/ll was 4.53" [16]. In another
study, "low number of T4 cells was the highest risk
factor for HIV infection" [17].
That the supposed effect, immunosuppression,
precedes the cause, that is, HIV infection, was
recognised by Montagnier as long ago as 1985:...
[dus gevolg komt voor oorzaak !!!!]
[en voor an encore]
At present it is accepted that HIV plays no role,
either directly or indirectly, in the causation of KS
[20,21].
The HIV theory predicted that HIV was sexually
transmitted and therefore AIDS would spread
throughout the heterosexual population. This has
not occured. In fact data from the largest, longest,
best designed and executed studies available conducted
in the USA and Africa show that HIV is not
heterosexually transmitted [22-25].
UNQUOTE
------------------------------------------------------
My cure gives you pure lifeforce, it seems :-).
------------------------------------------------------
I am not saying that I master the subject, but I have
a good notion how stress acts on the metabolism of the
liver.
------------------------------------------------------
> your explanation is simple schoolboy stuff hardly
> any medical breakthrough
I explained it to several doctors and there was one
that claimed he already knew and understood, but I
doubt that he did. I had to give him all the
information, and I am sure that he never had a clue.
He kept agreeing with the documents I produced. There
was zero input from his side, but he said it was
exciting stuff. Schoolboy stuff ? This doctor was the
top anaestesist from several hospitals. He told me
litterally "you sure did your homework". So now you
can conclude it was schoolboy stuff after all.
------------------------------------------------------
I will launch a press campaign at the latest in
september. You will immediately recognize my product'
s name when you see it.
------------------------------------------------------
Chronic fatigue is due to lack of nutrients essential
for a number of bodily functions, but especially for
the immune system.
------------------------------------------------------
Hay fever is different from chemical sensitivity, also
a sign of severe CFS-ME. These same essential
nutrients are used by the body to eliminate toxins, as
in household chemicals and even fruit odours. The body
cannot eliminate toxins and reacts heavily to any
minor increase of chemical or toxical load.
------------------------------------------------------
For arguments sake, let us presume that my cure
consists of taking vitamin C and green tea together.
If I succeeded in getting it patented, how am i going
to enforce it? There is vitamin C and green tea
available separately everywhere..
------------------------------------------------------
> Can't you bung all these ingredients of yours into
> one supplement and then give it a brand name and
> then sell that product? An example of this approach
> is the people who make Threelac for candida -
> AFAIK, all the ingredients in that are things found
> in regular food or the component in other
> supplements. You'd then have a patent on the brand
> name, and maybe you could stick other non-active
> ingredients in there to make it harder for people
> to work out what the active ingredients are?
Good thinking.
-------------------------------------------------------
My debts are accumulating, I have 4 euros left for
food today (for 3 persons and 6 cats), but maybe I can
sell some product today (repeat bussiness).
-------------------------------------------------------
I am a very nervous person, and my financial situation
is very bad. I have no benefits whatsoever. My resume
is almost empty at 46, due to cfs. The Belgian
government keeps taxing me each year as if I was a
healthy person. They assume I moonlighted the whole
time in IT. I live without passport or identity card,
as an illegal in my own land, due to cfs. If the
police stops me I spend three hours in the police
station. I lost my drivers licence, and cannot get it
renewed. Legally, I am entitled to drive, but if the
police stops me, it three hours in the police station
again, until they check everything. The police called
the company where a friend rented a car for me, he
does that because he realises the importance of my
work, and because of that they would not rent a car to
him anymore. CFS is "suspicious" I guess.
-------------------------------------------------------
Of the added benefits of taking it continously, I
am not yet sure. I have people reporting that the
effects last more than 8 months without diminishing.
but if you drink a lot, smoke a lot and have lots of
stress, then it may go faster. I have to think out a
solution to that.
And also, stress may burn out the ready available
amount of the nutrient, but the nutrient is stored in
muscles and the liver, where it is freed again if
necessary.
--------------------------------------------------------
The real example from the real world.
I get a report from "Patrick", age 55, retired officer
Belgian Army, that since he started taking it, he had
no more bouts of his otherwise rather severe psoriasis.
I know of several people with psoriasis, and contact
them, Veronique has severe psoriasis and fatigue. She
has to sleep in the afternoon, has to drag herself
doing the household. She does not care about the
fatigue so much, her looks destroyed by psoriasis, she
really hates that. She starts a ten day course, I
supply for free. Her husband works in construction,
and she works as a medical secretary, but is on sick
leave now, because of psoriasis and fatigue. The first
reaction of the doctor she works for to her skin
problems is that he will fire her, he does not want
someone with a visible ugly rash receiving his
patients. But he laters apologizes. Her husband makes
good money and both have saved enough to buy an extra
house, as an investment, because they already own the
house they live in.
The onset of her fatigue and psoriasis, was some
severe psychological shock, something to do with her
brothers dead (she found him after suicide, I presume,
she is not specific, I have to guess).
So she starts the cure, and four days later I meet
Franky in the pub. Her fatigue cleared after two days
! She does not has to sleep in the afternoon anymore,
and has energy to do the household.
I ask Franky to call me back after the cure, and
report, but he does not call me. I ask him several
times later, he always promises to call me, but never
does.
After a few weeks I meet her in the supermarket, and
she is *shining*, with lots of energy, I talk to her
and she says she feels energetic, she has no more
psoriasis in her hair, and on her body, it has
improved by 95 %. Now and then a small spot.
-----------------------------------------------------
About nine months later, I talk to Franky again, and
he is very happy, because his wife lost weight,
because of all this energy and courage she now has.
Remember, Ianw, she was only on a TEN DAY course, and
not even on a high dosage.
-----------------------------------------------------
Suppose I just tell you how it works, and then go find
another activity, since it is no longer a secret and
it now belongs to everybody. You try it, but in a
wrong way, as I have seen people do often the last
year(1). It does not work for you then, and it gets
buried. I no longer pursue it because I can't make
money out of it, and you think it does not work.
Maybe in the next twenty to eighty years, as Jeremy
Bearman predicted here, someone will see the solution
again, and decide to do the same thing, make it public
to some future Claire Coult. And we are of to another
80 years of CFS.
(1) they take the components separately and serially,
instead of together. Or they decide to go with A only,
because the dog has eaten B. Or the wife like the
smell of B anf he likes the smell of A, so the couple
decides that she takes B and he takes A. And so on.
Real life stories.
-----------------------------------------------------
My cure boost the human body's immune system, and
mycoplasmae and fungae simply can't cope with that.
And that is why they could thrive in the first place,
because of a weakened immune sytem.
------------------------------------------------------
In his video DR Hooper speaks about overlapping
symptoms. I am taking a very educating guess in saying
that my cure will work for all these "overlapping
symptomps" diseases, it is this same kind of reasoning
that put me on the right track for cause and cure of
cfs.
Gow is seeing ghosts, and I can perfectly explain that
with my theory. It is perfectly normal for a person
with CVS, and all the overlapping diseases, to have
lots of errors in copied dna. Erroneously copied dna,
will copy much more in an cvs and related diseases
person, than in a Healthy person. That also means that
cvs and related will be more susceptible to cancer.
There are not yet studies available on this, but for
cardiovascular diseases dr Hooper already confirmed my
theory.
------------------------------------------------------
I did not start with nervous system. I started with a
genuine intrest in all human suffering.
I had this recurring and severe bronchitis, and I
thought my extreme fatigue was caused by the
bronchitis. When I finally realised this
bronchitis/pneumonia had fungal causes, and took meds
for that, it cleared so much fatigue that I only then
realized I had CFS all my life.
Then I noticed that fungal pneumonia occurs in CFS and
AIDS patients. And that 95% of the symptoms of aids
and CFS overlap. I noticed that early 2000 by looking
at the cures that were current. I did not have to wait
for dr Hoopers video in 2005 to realize that.
------------------------------------------------------
My cure works for people with all sorts of fatigue,
and all sorts of health problems. More than 150 have
tried and all feel lots better.
------------------------------------------------------
No, you completely misunderstood that. It got better
with antifungals, but I crashed again.
------------------------------------------------------
If you talk about antifungals : some doctors now, some
deny it, and for many patient it does not work, it no
longer worked for me, either.
If you talk about my cure : I checked everywhere and I
never saw it applied for CFS-ME. And I could also take
the following logic, from the results I and 150 other
have, I know it is not applied yet, because many
people would be cured and talk about it.
On the many patient reports on the internet I read, I
never saw it applied.
------------------------------------------------------
Let me state it this way : My invention is not in the
public domain. It is my intellectual property.
------------------------------------------------------
And yet it took 35 more years for doctors to realize
that you could also cure stomach ulcers with
antibacterial antibiotics. Another spark of reason.
I needed several "sparks" in a row, in order to get
everything right. It was spread in bits and pieces of
information, even something I found very weird at age
11 when I read a medical encyclopedia, it said that
the liver is worse of from a household quarrel than
from a copious diner with wine. It was this sentence
that introduces "stress" into my theory of CFS. Of
course I checked and saw it was confirmed by studying
cortisol metabolism, the "fight or flight" principle.
------------------------------------------------------
You can even see some residue of cfs in my face : when
my immune system kicked in, the left facial nerve knot
inflamed, and the left side of my face was paralyzed
for a while. After the infection cleared, that side
now looks healthier than the right side. I am not
imagining things, I just had it checked by my
roommate, he confirms that the left side of my face
looks "less tired" than the right side. There must be
a lingering problem with my right side facial nerve
knot. It is barely noticeable, but if I point
someone's attention to it, then you can clearly see it.
------------------------------------------------------
Mycoplasma infections are not the cause of CFS, but
the result of the failing immune system.
First, the body can't efficiently fight the MP
infection, because it lacks the necessary nutrients.
Secondly, the fight against MP consumes these vital
nutrients, thereby causing CFS to worsen.
Antibiotics can help, but antibiotics need to be
eliminated by the body, and the body uses the same
nutrients to brak down the antibiotic, so the cfs
sufferer will eventually crash again.
------------------------------------------------------
> How do you cure it?
With the correct nutrients.
I saw in a spam mail the name "nutraceuticals".
------------------------------------------------------
There are several manufacturers. They supply to
pharmacies all over Europe.
------------------------------------------------------
I think it is about as safe as a "nutraceutical" can
get. Vitamin C is more dangerous.
Doing nothing about your nutritional deficiency is
actually more dangerous. Not only for you but also
for your children. If you do not have enough of
these nutrients, your breast milk also lacks them.
And these nutrients are extremely important for life
that develops. I gave them to a completely starved
stray kitten that I adopted, and now it's supercat.
Muscular, energetic, bright and shiny fur.
----------------------------------------------------
Stress causes specific nutrients to get used up very quick.
Toxines too, as the liver needs them to remove them from the bloodstream.
I was affected as a child, since I was not breastfed, my mother used
powder from the pharmacy in 59. She always cooked vegetables for hours,
and soups for days, making sure all vitamins had evaporated. Limonade
and sweets was brought in by truckloads, and consumed by the bucket.
Sugar makes you burn up essential vitamins even faster.
Only lean meat was consumed, which also gives not the full acces to
these nutrients.
My mother became more and more hysteric, adding stress to the overall
picture.
And an infection gave the final blow, a lingering infection, that was
treated by the doctor by loads of antibiotics, then still modern and
amazing. Again, the body needs to breakdown even antibiotics, by using
the nutrients.
Infections are a symptom and a cause, you get infections easier because
you are low on these nutrients, and fighting the infection with its
associated toxins consumes even more of your precious reserve of them.
Stress therapy, or even stress medication, can work, because, by
eliminating stress, the body consumes less of these nutrients, and the
normal daily intake restores the reserve. But one word of caution in
the case of medication, the body uses these essential nutrients again to
remove the medication from the bloodstream.
Some of cfs/me sufferers react violently to any increase of substances
that needs to be eliminated from the body. Some foods contain or
generate such by-products.
Alcohol (in excess) and aspartame are also to be avoided.
I met a lot of people that drank their way into cfs/me.
It is usually not recognized as such, since people blame it on the
effect of the long term alcohol abuse.
I see light fatigue, medium fatigue, severe fatigue, chronic fatigue,
ME, MS and even ALS as a continuous spectrum, caused by lack of these
specific nutrients.
-----------------------------------------------------
I am a person which life was and still is completely
destroyed by cfs. The Belgian government is one of
the harshest on cfs, no benefits WHATSOEVER, zero,
zilch, nil, null, in 25 years. And I never even knew
I had cfs, because I suffered from it since the age
of 10. When I was 40 I accidently took sporanox, and
sort of awoke. The Belgian government kept and still
keeps taxing me 9000 pound yearly, altough I had no
income since 1990. I have to go into hiding, or they
will even impound this crummy 120 pound second hand
laptop I am typing on. They compare me with a
healthy IT professional, and tax along.
------------------------------------------------------
He was sceptical too, he had a wound that did not
heal after surgery, now 4(!) years ago. He started
on sunday 10 days ago, his wound is already half
healed now, and he can use that leg again. He used
it more like a walking stick than as a leg, he tells me.
And of course, now he wakes up in the morning at
7am, and does not feel a bit tired anymore.
------------------------------------------------------
I found this cure by throwing all the dogma's
overboard and just seeing the facts. And a very
small bit of luck.
------------------------------------------------------
I am still amazed everytime a report comes in.
It reactivates the immune system, and improves
health in general. Did I tell you what people report
about improved erections/sex? Rather logical, it
improves also health in general.
------------------------------------------------------
I cured an old cat from fatigue, have you ever tried to
placebo a cat ?
The cause is 100% physical, it is a deficiency of
essential nutrients. These nutrients are burnt up by
stress or toxic factors.
I remember a line from a medical encyclopedia I read
when I was 10 or so : it said "...but a family fight can
be much worse for the liver than a copious dinner with
lots of alcohol"
If you abolish stress, the normal intake by normal food,
will eventually restore the level of these nutrients,
if your shortage is within reasonable limits. I ate
Health food for years, and I never recovered because of
that, but I am a nervous person, and my nerves quickly
burn me out, my shortage was huge, and still is, because
I am still getting better every day.
Today, I can manage enormous stress, because I replete
these nutrients on a daily and sufficient basis.
------------------------------------------------------
Only when you get less nervous, and reduce your stress,
you will burn up less of the essential nutrients, that
your body needs in order not to get CFS.
------------------------------------------------------
> you cant talk tour way out of cancer?
The mechanism for cancer is the same as for CFS. So actually, yes, you
can. If by talking you reduce your stress levels, you reduce your
chances for cancer. It is easier of course, to supplement the nutrients
that you burn by stress. I am having so much stress, because nobody
listens to me about my cure, that I sometimes even burn up the ample
supply of stuff I feed myself. I am a nervous person, so that is most
certainly why I wound up with cfs in the first place.
> I have done a lot of research in cfs and I know we dont know a lot about
> nervous systems, it is a grey area and thats why ......no known cure.
You forget the role of the immune system. That is also impaired.
I found which substance that feeds them both. And that was the right
candidate.
> but I have started taking vitamin,mineral supplemts again, raw juice so I
> will see how that goes and I hope a nutritional defiency is all that
> remains.
That does not help. Wrong supplementation makes things worse.
The nutrient you lack is then used to break down the ones you took in
excess. And you are worse of than before. That happened to me several
times.
------------------------------------------------------
I can announce you that I contacted an so called "authority" on chronic
fatigue, and that my views will be tested in an academic environment.
If I am wrong, I will admit it here and plaid guilty.
But the facts I have today, indicate me to think otherwise.
------------------------------------------------------
As I said my cure comes with money back guarantee, and earlier this week
the pub owner who uses my stuff to drink 20 beers and smoke 2 packs a
day, work 20 hours and stay on his feet (no drugs or uppers, only
nutrition !)
------------------------------------------------------
Actually, I found cause & cure for chronic fatigue by looking for a way
to help my liver recover from three years of Sporanox (anti fungal,
without sporanox, I reverted again to a cfs-zombie).
My method helps recover your liver completely and at the same time is an
excellent anti inflammant.
------------------------------------------------------
By A. Hässig, H. Kremer, S. Lanka, W-X Liang, K. Stampfli
May 1998
"
...
What is the laboratory finding "anti-HIV-positive" based on?
In a series of preceding reports we have discussed this
question in detail (11-14). We came to the conclusion:
the laboratory finding "anti-HIV-positive" is primarily
the expression of an autoimmune activation of the immune
system linked to a persistant catabolic state of
metabolism. In view of the fact that the diseases
grouped under the term AIDS are limited to risk groups
such as homosexuals, drug addicts and recipients of
blood products contaminated with parenterally
transmitted hepatitis inductors, the question is raised,
whether the anti-HIV test determines autoantibodies
directed against cell envelope structures with a
specificity to the body's own proteins of the host
cells. It has been known for over twenty years that
chronically active hepatitis (currently hepatitis B,
hepatitis C and autoimmune hepatitis without evident
antiviral antibodies) react by the formation of
autoimmune antibodies directed against cyto-skeletal
proteins of the liver cells. Thus, the raised
anti-actin-autoantibodies are pathognomonic for
chronically active hepatitides (15). JOHNSON et al., in
1965, were the first to report on
anti-actin-autoantibodies (16). They described
autoantibodies directed against smooth muscle cells and
showed that this had to be considered as characteristic
indication of "lupoid hepatitis". In 1973 GABBIANI et
al. demonstrated that autoantibodies directed against
smooth muscle cells react with actin-containing
microfilaments (17). Further investigations indicate
that autoantibodies with anti-actin specificity are to
be classified within the big group of autoantibodies
against filamentous proteins of smooth muscle fibres. 3
- 18% of healthy individuals present low titer
autoantibodies against cyto-skeletal proteins (18). High
titer anti-actin autoantibodies, on the other hand, are
only found in patients suffering from chronically active
hepatitis and/or biliary cirrhosis (19). In 1994 BERMAS
et al. showed that both sera from patients with lupus
erythematosus and from mice suffering from the same
illness react with glycoprotein 120 and peptides of the
postulated HIV-1 envelope (20). They further proved that
control sera of healthy individuals and patients with
other autoimmune diseases contain small amounts of the
same autoantibodies. Last but not least, they showed
that autoantibodies reacting with glycoprotein 120 do
not possess antinuclear specificity. They refrained from
investigating a specificity against cytoskeletal
proteins of these autoantibodies.
...
"
--------------------------------------------------------
Even Spencer's "Forced Hostel Diet" explains to me
why his situation did not become worse.
Actually, eggs, spam and blackpudding are better for
cfs/me sufferers than lean muscle-meat.
--------------------------------------------------------
Before he came up with the "Cure":
There is a substance in "red bull", Gluthatione,
that helps the liver get rid of all sorts of
toxins. Folic Acid and n-acetylcyteine helps too.
manf...@lycos.com
peddling his "cure".
Folks were talking about folic acid way back when:
Don Sipler Jan 4 1998, 3:00 am Newsgroups:
alt.support.skin-diseases.psoriasis
I'm one of the people talking about Folic Acid. But, it alone is not
effective. Folic Acid, which is a B vitamin, must be combined with
vitamin B12. My theory, and I have researched it extensively, is that
we
psoriacs do not absorb B12 well enough from our food. To correct this
the
B12 level in our blood must be raised by either injections of
Hydroxycobalamin(B12) or Sublingual Cyanocobalim(B12) orally. Because
we
do not absorb B12 well from food taking pill B12 doesn't work. The
Sublingual liquid I have found to be very convienent and works well. It
is placed under the tongue and is absorbed directly into the blood
stream. The brand I use is called B Total and can be purchased in
health
food stores or you can order it from the mfg at 1-800-700-0770 for
$11.95
for a two month supply. I take the B12 1000mcg once per day and 800mcg
of
Folic Acid 3 times a day with meals. For me it takes about a week to
start seeing results, far less redness and flaking, and clear evidence
of
skin beginning to heal itself. Once clear this dosage could be reduced
Also, I don't know if this was mentioned here before:
Seven patients with long-standing psoriasis were given 20 mg of folic
acid 4 times per day. Marked improvements were noted after 3-6 months
of treatment. Three additional patients who had previously received
methotrexate treatment for psoriasis were also given folic acid. In one
patient, new lesions appeared all over the trunk in places where they
had never existed. One patient showed decided worsening and the third
patient improved considerably.
Comment: The rationale for using high-dose folic acid is based on the
fact that allopurinol, a xanthine oxidase inhibitor, is effective
against psoriasis. The author of the present study has found that folio
acid fortified with specific amounts of ascorbic acid (to keep it in
the reduced state as tetrahydrofolate) is also an effective xanthine
oxidase inhibitor. Although no controlled trials have been done with
folic acid, other clinicians have observed the same beneficial effect
against psoriasis that Oster reported more than a quarter-century ago.
Methotrexate interferes with folic acid metabolism and, for reasons
that are not clear, appears to cause an adverse reaction to high-dose
folic acid in some cases. However, for patients who have not previously
been treated with methotrexate, folic acid appears to be a safe and
promising therapy for chronic psoriasis. Of course, when using
high-dose folic acid, it is important to remember that it can mask the
laboratory diagnosis of pernicious anemia.
Oster KA. A cardiologist considers psoriasis. Cutis 1977;20:39-41.
Pete
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=pubmed&dopt=Abstract&list_uids=14616423&query_hl=2
Full text:
http://www.blackwell-synergy.com/doi/full/10.1046/j.1365-2125.2003.01907.x
Replacement therapy for vitamin B12 deficiency: comparison between the
sublingual and oral route.
Sharabi A, Cohen E, Sulkes J, Garty M.
Recanati Center for Medicine and Research and Clinical Pharmacology
Unit, Sackler Faculty of Medicine, Tel Aviv University, Tel Aviv,
Israel.
AIMS: To compare the efficacy of sublingual and oral administration of
500 micro g of cobalamin in subjects with cobalamin deficiency.
MATERIALS AND RESULTS: Thirty subjects with low serum concentrations of
cobalamin participated in the study. Subjects were randomly allocated to
receive one tablet daily of 500 micro g cobalamin sublingually or
orally, or two tablets daily of a vitamin B complex. Serum cobalamin
concentrations before treatment were 94 +/- 30 pmol l-1, 108 +/- 17 pmol
l-1 and 98 +/- 14 pmol l-1 in the sublingual B12, oral B12 and oral
B-complex groups, respectively. After 4 weeks, concentrations rose to
288 +/- 74 pmol l-1, 286 +/- 87 pmol l-1 and 293 +/- 78 pmol l-1,
respectively. The increase in each group across time was statistically
significant (P = 0.0001, differences [95% confidence intervals] 194.2
(114.5, 273.9), 178.3 (104.2, 252.4), and 195.1 (135.0, 255.2) pmol l-1,
respectively). There was no significant difference in concentrations
between the treatment groups.
CONCLUSION: A dose of 500 micro g of cobalamin given either sublingually
or orally is effective in correcting cobalamin deficiency.
PMID: 14616423
--
All the best,
Pete
------------------------------------------------
Home Page: http://users.bigpond.com/lansma
Location: 42°53'S; 147°19'E
randall
of these. Sorry)
Cruiser wrote:
> I have compiled a list of quotes, from Hayek's posts, which may give clues
> about his "Cure"
>
> Read it over, and if you have any bright ideas, let us all know.
First, this is the earliest I could get to this. I've been really busy.
Not overawed by your document dump, but time has been short to respond.
But haven't you answered your own question as to uwe's key ingredient?
(...)
There is now growing evidence for the possible control of different
stages of the cancer induction by inhibiting beta-glucuronidase with
D-glucaric acid derivatives, especially with its salts (D-glucarates).
D-Glucaric acid has been found in many vegetables and fruits.
Therefore, the consumption of fruits and vegetables naturally rich in
D-glucaric acid or self-medication with D-glucaric acid derivatives
such as calcium D-glucarate offers a promising cancer prevention
approach.
PMID: 15035900
Looks like a fix to me. The body is always blocking the big C. So if
this make that
process that much easier then your liveR has time for making those rock
hard
deals in Uwe's sleep. lol
>
> Uwe Hayek Quotes:
> ---------------------------------------------
> Today however, I pity the microbes, bacterial, viral
> or fungal, as it seems my immune systems now crunches
> about everything without the help of any antibiotic or
> antifungal.
Sorry. Not buying it. He came uP with his physics theories (a clock is
a inertia meter?)
without having used this stuff. Now that he is, i'm not seeing any new
theoris on the physics group he used to frequent.
Back to the last quote.
Ok. So he's taking some OTC suPPlement. We know that. We just don't
know which one. As he seems to think it's a way for him to get rich.
lol
> my cure's components can be found in breastmilk
> ----------------------------------------------
The big deal there is DHA,
http://www.betterhumans.com/News/4643/Default.aspx
Kids also get AA via omega-6,
http://www.martekbio.com/Nutritional_Products/Introduction.asp
What uwe is most likely thinking hopefully is about the ratio of n3 to
n6. If not, then what's the big factor in breast milk?
As psoriatics we have to much AA (arachidonic acid) from n6 (omega6).
But even without it, our bodies will simply make it. That's been stated
here a few hundred times.
It's best to avoid most omega-6 vegetable oils (soy bean, corn etc)
And to make sure your ratio is working towards a balance. Take one
tablespoon
a day of a good quality flax seed oil. Found in the refer section of
most health food stores.
> (Regarding a man taking the cure)
> The second day, the lump in his neck turns blood red.
> I think that is a good sign, since most cancers are
> anaerobic, no oxygen rich blood gets to them.
> ----------------------------------------------
> Some twenty people take it for more than a year now,
> including myself, and the most annoying side effects
> are these painfull rock hard erections that last
> almost all night ... :-) Which is not that long, since
> 4 to 5 hours sleep is enough.
Yeah right! All those pesky teenage years come back now?
What is he? Like 60 already? I don't even want to know.
To much info. TMi....
> -----------------------------------------------
> Suppose some virus depletes a lot of essential
> nutrients because your body needs to fight it.
>
> That virus is gone, but you are left with an immune
> system without fuel. With then again leads to herpes
> to linger, and the medical profession clueless.
> Because herpes is the symptom, not the cause.
Okay. But he isn't giving us the anwwer. So let me run anything.
pentosidine
http://groups.google.com/groups?q=pentosidine&qt_s=Search
Is creatine in uwe's formula? Or alt-711,
http://groups.google.com/groups?q=alt-711+psoriasis&qt_s=Search
You and I linked on that one. So does TM,
http://morelife.org/researchems/ALT-711.html
Back to pentosidine,
http://www.greatplainslaboratory.com/images/crosslinkedp.gif
Did uwe visit this site to figure out how to deal with CFS,
http://www.greatplainslaboratory.com/yeast2.html
Here's a clue for curing one autoimmune condition.
Single molecule at cause of MS,
http://www.hopkinsmedicine.org/Press_releases/2005/09_22a_05.html
Hopkins researchers have discovered a single molecule that is a cause
of an autoimmune disease in the central nervous system, called
transverse myelitis (TM), that is related to multiple sclerosis.
&
http://www.medicalnewstoday.com/medicalnews.php?newsid=31072
Well at least I have some meat in my taco's. Where's his?
He must need the $$'s for all those fantasy girls to take care of
his clintonesque needs?
So, if he's found a single ingredient that seems to help, then he's
already told us about the ones he's used successfully prior to it.
And that is NAC.
No secret there as he's mentioned it over a dozen times.
> -----------------------------------------------
<sniP>.
> -----------------------------------------------
> But you should avoid eating to much, as excess
> equals toxins, and depletes antitoxin reserves. It
> is on this mechanism that dieting, paced exercising
> and cbt works. Haphazardly, but it works in some
> cases, and my theory explains it, as a good theory
> should explain *all* ins and outs. Or at least as
> much as possible.
Ok. Here you go if you pig out it ain't gonna work. Like
we should know now that he's got an out. Your weak it's your
fault you don't get well.
<sniP>
> My theory about that is :
> every nutrient in excess is a burden, and causes
> more harm than relief. So you have to do things
> right : only supply the right thing you need.
> Because in chemistry : for every molecule you supply
> , you must supply another one to react with.
In this case. Your screwed Cruiser. All those excess grams and mg's
of what your taking is only making you worse. According to uwe.
>
> If you need A and B to get rid of toxins, and you
> take C,D,E,F,G,H,I,J together with it, in excess, as
> usually these "high potency" formulations do, you
> are worse of compared to not taking anything.
> > I was also quite hopeful about Co.Q10, since it's
> > mentioned in a couple of books I've got in the
> > CFS section, and have been taking that for over a
> > month (200mg a day for the past 2 weeks) but
> > haven't noticed any effect from that either.
>
200 mg's a day of CoQ10 and I'm flying and feeling fine. Usually
i only take 50 mg's per day.
As to the rest of this i'll post some things that may or not be
germane.
A lot of glutamine on this immune nutrition chart. It flares me btw,
http://www.platinumperformance.com/research/articles/category9.cfm
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=11895153
Glutamine: essential for immune nutrition in the critically ill.
Critically ill patients on intensive care units are at an increased
risk of sepsis, which is a major cause of mortality in these patients.
Recent evidence suggests that impairment of the functioning of the
immune system contributes to the development of sepsis in such
patients. In particular, monocytes show reduced expression of HLA-DR
antigen, associated with impaired antigen presenting capability and
decreased phagocytic activity; lymphocytes show decreased proliferation
in response to mitogens and T-helper cells show a shift in the Th1/Th2
ratio consistent with impaired immunity. The amino acid glutamine
becomes conditionally essential in the critically ill, yet such
patients frequently have a marked deficiency of glutamine; the reasons
for this are still unclear. Glutamine is required by the cells of the
immune system both as a primary fuel and as a carbon and nitrogen donor
for nucleotide precursor synthesis. In vivo studies have demonstrated
that glutamine is essential for optimal immune cell functioning for
monocytes, lymphocytes and neutrophils. A number of trials of patients
fed by the enteral or parenteral route have shown improved infectious
morbidity when supplemented with glutamine. However, the exact
mechanism of glutamine action in these patients remains to be
determined.
PMID: 11895153
Could it be something in one of these plant foods that benefit the
immune system,
http://www.immunecentral.com/infotemplate.cfm-1694-69-1
Let me find a chart on phase I and II enzymes. This is good but hard to
read which enzymes
are under phase I and II (p450, glutathione etc ) The iron stuff may
have a big clue or two as WELL as Phase III expoter, frataxin (not to
mention the scavengers)
http://www.tox.ncsu.edu/faculty/tsuji/
(...)
studies from our group have shown that normal fibroblasts transformed
by the adenovirus E1A oncogene become susceptible to the cytotoxic
action of tumor necrosis factor (TNF)
(...)
One significant target for this viral oncogene was the H subunit of
ferritin (Tsuji et al., J. Biol Chem., 268: 7270-7275, 1993). Ferritin,
consisting of 24 subunits of the H and L types, is the major iron
repository and plays a role in regulating iron homeostasis in
eucaryotic cells. We focused on the molecular mechanisms of
transcriptional repression of the ferritin H gene and several other
cytoprotective genes by the E1A oncogene, as well as the elucidation of
their impact on susceptibility to the cytotoxic action of TNF and
oxidative stress. We demonstrated that the E1A responsive region of the
ferritin H gene is a 37bp region composed of an _____AP1_____-like
sequence and a 22bp Sp1-like dyad symmetry element (termed FER-1)(Tsuji
et al., Mol. Cell. Biol., 15: 5152-5164, 1995).
Could only find one abstract on the viral oncoprotein E1A and P,
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=pubmed&dopt=Abstract&list_uids=12954631
But going back to AP1-like (is that like AP1?) we strike it rich for
psoriasis as it triggers cytokines,
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=pubmed&dopt=Abstract&list_uids=16163348
Psoriasis-like skin disease and arthritis caused by inducible epidermal
deletion of Jun proteins.
Zenz R, Eferl R, Kenner L, Florin L, Hummerich L, Mehic D, Scheuch H,
Angel P, Tschachler E, Wagner EF.
Research Institute of Molecular Pathology, Dr. Bohr-Gasse 7, A-1030
Vienna, Austria.
Psoriasis is a frequent, inflammatory disease of skin and joints with
considerable morbidity. Here we report that in psoriatic lesions,
epidermal keratinocytes have decreased expression of JunB, a gene
localized in the psoriasis susceptibility region PSORS6. Likewise,
inducible epidermal deletion of JunB and its functional companion c-Jun
in adult mice leads (within two weeks) to a phenotype resembling the
histological and molecular hallmarks of psoriasis, including arthritic
lesions. In contrast to the skin phenotype, the development of
arthritic lesions requires T and B cells and signalling through tumour
necrosis factor receptor 1 (TNFR1). Prior to the disease onset, two
chemotactic proteins (S100A8 and S100A9) previously mapped to the
psoriasis susceptibility region PSORS4, are strongly induced in mutant
keratinocytes in vivo and in vitro. We propose that the abrogation of
JunB/activator protein 1 (AP-1) in keratinocytes triggers
chemokine/cytokine expression, which recruits neutrophils and
macrophages to the epidermis thereby contributing to the phenotypic
changes observed in psoriasis. Thus, these data support the hypothesis
that epidermal alterations are sufficient to initiate both skin lesions
and arthritis in psoriasis.
PMID: 16163348
So? Well so? So its big already. Doesn't the IP6 trial show an iron
relationship with P? Yes!
Back to that link with AP1-like sequence and ferritin,
"While iron plays an essential role in many cellular functions, excess
iron is potentially harmful because it can catalyze the formation of
reactive oxygen species (ROS) via Fenton chemistry. Ferritin, a major
iron storage protein that plays a prominent role in maintaining
intracellular iron homeostasis, could be a suppressor of the ROS
generation by sequestration of intracellular excess free-iron. Frataxin
is a mitochondrial protein that appears to regulate iron efflux in
mitochondria."
Look at the jpg on the site if you missed it above,
http://www.tox.ncsu.edu/faculty/photos/Yoshi-DDCD26-resize.jpg
Could there be some excess oxidative stress?
http://www.tox.ncsu.edu/faculty/photos/YTsuju5.jpg
Well, not one frataxin and psoriasis abstract in pubmed. Maybe it
connects to a P connection?
For those who want to explore enzymes further,
http://www.netdoctor.co.uk/focus/nutrition/facts/detoxification/detoxification.htm
For those wanting to try Cloves,
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=pubmed&dopt=Abstract&list_uids=16216483
Eugenol-The active principle from cloves inhibits 5-lipoxygenase
activity and leukotriene-C4 in human PMNL cells.
Raghavenra H, Diwakr BT, Lokesh BR, Naidu KA.
Department of Biochemistry and Nutrition, Central Food Technological
Research Institute, Cheluvamba Mansion, Mysore, Karnataka 570 020,
India.
Polymorphonuclear leukocytes (PMNL) play an important role in the
modulation of inflammatory conditions in humans. PMNL cells recruited
at the site of inflammation, release inflammatory mediators such as
leukotrienes, proteolytic enzymes and reactive oxygen species. Among
these, leukotrienes are implicated in pathophysiology of allergic and
inflammatory disorders like asthma, allergic rhinitis, arthritis,
inflammatory bowel disease and psoriasis. 5-Lipoxygenase (5-LO) is the
key enzyme in biosynthetic pathway of leukotrienes. Our earlier studies
showed that spice phenolic active principles significantly inhibit 5-LO
enzyme in human PMNLs. In this study we have further characterized the
inhibitory mechanism of eugenol, the active principle of spice-clove on
5-LO enzyme and also its effect on leukotriene C((4)) (LTC(4)).
Substrate dependent enzyme kinetics showed that the inhibitory effect
of eugenol on 5-LO was of a non-competitive nature. Further, eugenol
was found to significantly inhibit the formation of LTC(4) in calcium
ionophore A23187 and arachidonic acid (AA) stimulated PMNL cells. These
data clearly suggest that eugenol inhibits 5-LO by non-competitive
mechanism and also inhibits formation of LTC(4) in human PMNL cells and
thus may have beneficial role in modulating 5-LO pathway in human PMNL
cells.
PMID: 16216483
> Rhodiola. No effect
> whatsoever.
I'm not surprised.
>
> > The only supplement I've had any lasting success
> > on so far is the high potency B-complex
> > supplement I'm taking which has significantly
> > stabilised my anxiety/panic symptoms. But that's
> > it.
And did zill for my psorasis. WE agree. Yeah!
>
>
> Again same thing as the other high potency formulas.
> I used to take very strong doses of B6 for bleeding
> gums, in my early twenties. When I take one single
> high dosage pill of that now, I get sick and my
> liver aches.
Interesting. It's a clue.
>
> I never had any bad side effect with my formula.
> I always feel better after taking it. And so says
> everybody who used it.
> -------------------------------------------------
> Cold sores disappear rapidly with my formula. After
> two days the sore is cured, and then heals in a
> week. They do not return. Acne also disappears quickly.
> -------------------------------------------------
> The cure works best in a no stress, no alcohol, no
> coffee, little tabacco, but plenty of relaxation and
> detox environment, at least for the first five days.
> For the nutrients to build up at least ten days is
> needed.
Gosh if he was only going to give us a better clue.
Tight liPPed isn't he?
> --------------------------------------------------
> I plan on guarantying no hart attacks, no strokes, and
> no cancer up to 65 years.
What a deal. What a flake?
<really big sniP>
I find the rest a waste of time.
randall... what's the secret. I think cruiser's got it.
randall
> I have compiled a list of quotes, from Hayek's posts, which may give clues
> about his "Cure"
>
> Read it over, and if you have any bright ideas, let us all know.
First, this is the earliest I could get to this. I've been really busy.
But haven't you answered your own question as to uwe's key ingredient?
(...)
There is now growing evidence for the possible control of different
stages of the cancer induction by inhibiting beta-glucuronidase with
D-glucaric acid derivatives, especially with its salts (D-glucarates).
D-Glucaric acid has been found in many vegetables and fruits.
Therefore, the consumption of fruits and vegetables naturally rich in
D-glucaric acid or self-medication with D-glucaric acid derivatives
such as calcium D-glucarate offers a promising cancer prevention
approach.
PMID: 15035900
>
> Uwe Hayek Quotes:
> ---------------------------------------------
> Today however, I pity the microbes, bacterial, viral
> or fungal, as it seems my immune systems now crunches
> about everything without the help of any antibiotic or
> antifungal.
> ----------------------------------------------
Ok. So he's taking some OTC suPPlement. We know that. We just don't
know which one. As he seems to think it's a way for him to get rich.
lol
> my cure's components can be found in breastmilk
> ----------------------------------------------
The big deal there is DHA,
http://www.betterhumans.com/News/4643/Default.aspx
Kids also get AA via omega-6,
http://www.martekbio.com/Nutritional_Products/Introduction.asp
What uwe is most likely thinking hopefully is about the ratio of n3 to
n6. If not then what's the big factor in breast milk?
As psoriatics we have to much AA (arachidonic acid) from n6 (omega6).
But even without it, our bodies will simply make it. That's been stated
here a few hundred times.
> (Regarding a man taking the cure)
> The second day, the lump in his neck turns blood red.
> I think that is a good sign, since most cancers are
> anaerobic, no oxygen rich blood gets to them.
> ----------------------------------------------
> Some twenty people take it for more than a year now,
> including myself, and the most annoying side effects
> are these painfull rock hard erections that last
> almost all night ... :-) Which is not that long, since
> 4 to 5 hours sleep is enough.
Yeah right! All those pesky teenage years come back now?
What is he? Like 60 already? I don't even want to know.
> -----------------------------------------------
> Suppose some virus depletes a lot of essential
> nutrients because your body needs to fight it.
>
> That virus is gone, but you are left with an immune
> system without fuel. With then again leads to herpes
> to linger, and the medical profession clueless.
> Because herpes is the symptom, not the cause.
Okay. But he isn't giving us the anwwer. So let me run anything.
And that is NAC.
> -----------------------------------------------
<sniP>.
> -----------------------------------------------
> But you should avoid eating to much, as excess
> equals toxins, and depletes antitoxin reserves. It
> is on this mechanism that dieting, paced exercising
> and cbt works. Haphazardly, but it works in some
> cases, and my theory explains it, as a good theory
> should explain *all* ins and outs. Or at least as
> much as possible.
Ok. Here you go if you pig out it ain't gonna work. Like
we should know now that he's got an out. Your weak it's your
fault you don't get well.
<sniP>
> My theory about that is :
> every nutrient in excess is a burden, and causes
> more harm than relief. So you have to do things
> right : only supply the right thing you need.
> Because in chemistry : for every molecule you supply
> , you must supply another one to react with.
In this case. Your screwed Cruiser. All those excess grams and mg's
of what your taking is only making you worse. According to uwe.
>
> If you need A and B to get rid of toxins, and you
> take C,D,E,F,G,H,I,J together with it, in excess, as
> usually these "high potency" formulations do, you
> are worse of compared to not taking anything.
> > I was also quite hopeful about Co.Q10, since it's
> > mentioned in a couple of books I've got in the
> > CFS section, and have been taking that for over a
> > month (200mg a day for the past 2 weeks) but
> > haven't noticed any effect from that either.
>
200 mg's a day of CoQ10 and I'm flying and feeling fine. Usually
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=11895153
PMID: 11895153
PMID: 16163348
PMID: 16216483
> Rhodiola. No effect
> whatsoever.
I'm not surprised.
>
> > The only supplement I've had any lasting success
> > on so far is the high potency B-complex
> > supplement I'm taking which has significantly
> > stabilised my anxiety/panic symptoms. But that's
> > it.
And did zill for my psorasis. WE agree. Yeah!
>
>
> Again same thing as the other high potency formulas.
> I used to take very strong doses of B6 for bleeding
> gums, in my early twenties. When I take one single
> high dosage pill of that now, I get sick and my
> liver aches.
Interesting. It's a clue.
>
> I never had any bad side effect with my formula.
> I always feel better after taking it. And so says
> everybody who used it.
> -------------------------------------------------
> Cold sores disappear rapidly with my formula. After
> two days the sore is cured, and then heals in a
> week. They do not return. Acne also disappears quickly.
> -------------------------------------------------
> The cure works best in a no stress, no alcohol, no
> coffee, little tabacco, but plenty of relaxation and
> detox environment, at least for the first five days.
> For the nutrients to build up at least ten days is
> needed.
Gosh if he was only going to give us a better clue.
Tight liPPed isn't he?
> --------------------------------------------------
> I plan on guarantying no hart attacks, no strokes, and
> no cancer up to 65 years.
randall
Well? Do you want to make a wager on whether this,
http://www.health-marketplace.com/Calcium-D-Glucarate.htm
Is Uwe's magic X factor?
50 grams for under $20 here,
http://www.easycart.net/BeyondACenturyInc./Hormones_and_Related_Products.html#7410
Yet, we have to consider Uwe's rock hard erections, i suPPose,
http://www.easycart.net/BeyondACenturyInc./Amino_Acids_Single_A-L.html#0137
He may have stumbled into Bruce Ames Alcar (ala + alc) via the
backdoor? lol
I hoPe he wasn't sleePwalking. <G>
Perish the thoughts!
When i do the alcar trial, and i'm certainly going too as i've
mentioned it
at least three times iirc, i'm not going to say- step up to randall's
magic snake oil cure room and i'll cure what ails you, if and when i'm
totally clear of P. lol
NoPe. I'll give credit where credit is due. Doctor Ames and others
are pioneers in the field who deserve our respect and admiration.
Why come into the usenet and steal other folks work and charge money
for it as if you created it?
Certainly doesn't belong in a suPPort group.
What good would it have done for me to have taken that route?
Put a big fat target on my forehead, like uwe did?
randall... well, some may have wished that. lol
Cruiser
"randall" <ranh...@aol.com> wrote in message
news:1129497891.8...@g47g2000cwa.googlegroups.com...
> Cruiser,
>
> Well? Do you want to make a wager on whether this,
> http://www.health-marketplace.com/Calcium-D-Glucarate.htm
>
> Is Uwe's magic X factor?
>
Well I am not convinced, since it is not in breast milk, but I have picked
up some Organika Calcium D-glucarate 200mg, 60 capsules. I am adding it to
my RNA synthesis regimen. I just popped 800mg to start.
>
> Yet, we have to consider Uwe's rock hard erections, i suPPose,
Yes, I have found a not too credible comment on the net, one woman warning
other women to be careful when starting on Calcium D-glucarate, that too
high a dosage at the start can result in hormones levels being very skewed.
This may have some bearing. Glucuronidation processes hormones out the body.
Uwe, would be using big doses. I checked for toxicity and found one
reference that said up to 10 grams per day was not toxic.
-------------------------------------------------
http://www.drwardbond.com/index.asp?cat=64065
Is Calcium D-Glucarate Safe?
Compounds found in D-Glucarate occur naturally in foods that you eat every
day such as apples, grapefruit, broccoli, and cherries. Long term laboratory
studies report no toxic effects at dosages of 0.5 to 10 percent
of the diet. A review of all studies to date have revealed only beneficial
effects. In trials with the National Cancer Institute, D-Glucarate
administered to women at high risk for breast cancer have shown no evidence
of toxicity, even at very high dosages of 10 grams per day. Additionally, no
side effects have been reported.
-------------------------------------------------------
Also, I have been looking at Glycogen metabolism. Melatonin taken at bedtime
helps restore glycogen reserves and reduces liver lactate.
----------------------------------------------
Melatonin increases muscle and liver glycogen content in nonexercised and
exercised rats.
Mazepa RC, Cuevas MJ, Collado PS, Gonzalez-Gallego J.
Department of Physiology, University of Leon, Spain.
The effects of melatonin on several parameters of carbohydrate and lipid
metabolism were investigated in exercised and nonexercised rats. Animals
were run to exhaustion on a rodent treadmill at 24 m/min and a 12% slope.
Exercise resulted in a significant hypoglycemia and increased plasma levels
of lactate and beta-hydroxybutyrate, together with a significant reduction
of glycogen in muscle and liver. Muscle and liver glycogen content was
elevated and plasma free fatty acid decreased in nonexercised animals
receiving melatonin (0.5 or 2.0 mg/kg i.p). Melatonin at 2.0 mg/kg reduced
plasma lactate and increased lactate concentration in liver. When compared
to untreated exercised animals glycemia and muscle and liver glycogen
content were significantly higher in melatonin-treated exercised animals,
while plasma and liver lactate and plasma beta-hydroxybutyrate were
significantly reduced. Our data indicate that melatonin preserves glycogen
stores in exercised rats through changes in carbohydrate and lipid
utilization.
-------------------------------------------------
Cruiser
randall
Cruiser wrote:
> "randall" <ranh...@aol.com> wrote in message
> news:1129497891.8...@g47g2000cwa.googlegroups.com...
> > Cruiser,
> >
> > Well? Do you want to make a wager on whether this,
> > http://www.health-marketplace.com/Calcium-D-Glucarate.htm
> >
> > Is Uwe's magic X factor?
> >
>
> Well I am not convinced, since it is not in breast milk, but I have picked
> up some Organika Calcium D-glucarate 200mg, 60 capsules. I am adding it to
> my RNA synthesis regimen. I just popped 800mg to start.
Ok. Wager's off if you poPed one.
If it's in breast milk and isn't DHA or some lipid then we
have to go smaller.
Let's try this,
http://www.vanderbilt.edu/AnS/psychology/health_psychology/vanadylsulfate.html
If we have permeable intestines leading to the Th1 skew via LPS, then
VS may help in those regards?
http://www.sciencedaily.com/releases/2005/10/051012084200.htm
(...)
Next, experimental mice were pre-treated with vanadyl sulfate before
exposure to LPS. Recovery after illness of the vanadium-treated mice,
diabetic or not, was 50 percent faster than that of the untreated
control mice.
"With vanadyl sulfate being like IGF-1, we expected to see resistance
in the diabetic animals, but we didn't see that," Johnson said. "We saw
similar improvement. Thus it must have been acting through a different
pathway than do IGF-1 or insulin."
Johnson and Freund, also an adjunct professor of animal sciences and a
researcher in the immunophysiology and behavior program at Illinois,
theorize it may be vanadium's metal-related shape or its ability to
inhibit tyrosine phosphatases, which help to modulate signaling
proteins, in the immune system. Freund and colleagues last year
documented a connection between serine phosphorylation and
anti-inflammatory cytokines.
<sniP>
**********
Is the wager back on?
What does VS do for erections i wonder?
>
> >
> > Yet, we have to consider Uwe's rock hard erections, i suPPose,
>
> Yes, I have found a not too credible comment on the net, one woman warning
> other women to be careful when starting on Calcium D-glucarate, that too
> high a dosage at the start can result in hormones levels being very skewed.
> This may have some bearing. Glucuronidation processes hormones out the body.
> Uwe, would be using big doses. I checked for toxicity and found one
> reference that said up to 10 grams per day was not toxic.
>
> -------------------------------------------------
> http://www.drwardbond.com/index.asp?cat=64065
>
> Is Calcium D-Glucarate Safe?
> Compounds found in D-Glucarate occur naturally in foods that you eat every
> day such as apples, grapefruit, broccoli, and cherries. Long term laboratory
> studies report no toxic effects at dosages of 0.5 to 10 percent
> of the diet. A review of all studies to date have revealed only beneficial
> effects. In trials with the National Cancer Institute, D-Glucarate
> administered to women at high risk for breast cancer have shown no evidence
> of toxicity, even at very high dosages of 10 grams per day. Additionally, no
> side effects have been reported.
Beg the question if you could eat to much apples, grapefruit, broccoli,
and cherries.
It would seem by not eating enough of them it may lead to more problems
then eating to much.
>
>
> -------------------------------------------------------
>
> Also, I have been looking at Glycogen metabolism. Melatonin taken at bedtime
> helps restore glycogen reserves and reduces liver lactate.
I've been haPPily using melatonin for some time now. Even if it does
zero for P, I won't be stoPPing the use of it.
Can we say rock a bye bye baby? Works for me.
randall... VS and mel cocktail at slumber time for P?
Cruiser
> Cruiser wrote:
> > > Yet, we have to consider Uwe's rock hard erections, i suPPose,
> >
> > Yes, I have found a not too credible comment on the net, one woman
warning
> > other women to be careful when starting on Calcium D-glucarate, that too
> > high a dosage at the start can result in hormones levels being very
skewed.
> > This may have some bearing. Glucuronidation processes hormones out the
body.
> > Uwe, would be using big doses. I checked for toxicity and found one
> > reference that said up to 10 grams per day was not toxic.
> >
I forgot to mention that the woman warned that the hormone skewing could
cause
a headache.
That's funny.
IF (a big if ) men get all night erections, and women get a headache.
I was using DHA for a bit at the start of this, and I did not notice that it
helped in
any way.
Lactic Acid? It is in breast milk.
This guy seems to think it is good for restoring liver glycogen reserves.
http://www.cytosport.com/science/lacticacid.html
-------------------------------------------------
This site has a diagram showing lactate being turned into glucose.
http://www.unisanet.unisa.edu.au/08366/h&p2carb.htm
Cruiser
randall
Cruiser wrote:
> > Cruiser wrote:
>
> > > > Yet, we have to consider Uwe's rock hard erections, i suPPose,
> > >
> > > Yes, I have found a not too credible comment on the net, one woman
> warning
> > > other women to be careful when starting on Calcium D-glucarate, that too
> > > high a dosage at the start can result in hormones levels being very
> skewed.
> > > This may have some bearing. Glucuronidation processes hormones out the
> body.
> > > Uwe, would be using big doses. I checked for toxicity and found one
> > > reference that said up to 10 grams per day was not toxic.
> > >
>
> I forgot to mention that the woman warned that the hormone skewing could
> cause
> a headache.
>
> That's funny.
>
> IF (a big if ) men get all night erections, and women get a headache.
;/ Sounds nearly normal at some time in one's life.
>
> I was using DHA for a bit at the start of this, and I did not notice that it
> helped in
> any way.
>
> Lactic Acid? It is in breast milk.
>
> This guy seems to think it is good for restoring liver glycogen reserves.
>
> http://www.cytosport.com/science/lacticacid.html
Ok, so that means exercise will lower psoriasis. It's hard to
ignore that it is healthier, but even great marathoners and
olympians get P.
How much more should they stop exercising is the question.
If they had X% at their peak. Does/will it increase Y% when they
stop working out?
>From my own experiences I feel much better with the exercise program
going on.
> -------------------------------------------------
> This site has a diagram showing lactate being turned into glucose.
>
> http://www.unisanet.unisa.edu.au/08366/h&p2carb.htm
So, if you do exercise you'll want the most bang for your buck.
And creatine is cheaP, (check the BAC site for it)
http://bodybuilding.about.com/od/supplementationbasics/a/creatine.htm
Now, i'm getting tons of creatine via all the meat in my latest trial,
So i would have to go nearly vegetarian if i was to start taking
creatine in conjunction with all that lactic acid being generated.
randall... i sorta like the fruit acid (D-glucarate) thing still!
>
> Cruiser
cruiser
ago. I did nothing to clear psoriasis.
I just found this intereting bit.
http://users.rcn.com/jkimball.ma.ultranet/BiologyPages/E/Enzymes.html
Conversely, if a new substrate is made available to the cell, it may induce
the synthesis of the enzymes needed to cope with it. Yeast cells, for
example, do not ordinarily metabolize lactose and no lactase can be detected
in them. However, if grown in a medium containing lactose, they soon begin
synthesizing lactase - by transcribing and translating the necessary
gene(s) - and so can begin to metabolize the sugar.
Cruiser
randall
cruiser wrote:
> I used vanadyl sulfate for a few months when I was weight training years
> ago. I did nothing to clear psoriasis.
I used Vitamin C and IP6 many times over the years.
The Vitamin C flared me after awhile and the IP6 only helped
marginally.
Who knew the two to-gether would keep me clear for so long?
And now with the D-glucarate and ????, it could be even better.
At the BAC site, there must be dozens of things that cause a
rock hard... Well you get my drift.
We just need to find the uwe secret compound that's in breast milk.
How hard can that be?
randall... Attention all boobs, whats your secret?
Pete
http://www.psoriasis-help.org.uk/community/?board=general;action=display;num=1105618881;start=0
> I used Vitamin C and IP6 many times over the years.
>
> The Vitamin C flared me after awhile and the IP6 only helped
> marginally.
>
> Who knew the two to-gether would keep me clear for so long?
>
> And now with the D-glucarate and ????, it could be even better.
>
> At the BAC site, there must be dozens of things that cause a
> rock hard... Well you get my drift.
And here's another:
http://www.psoriasis-help.org.uk/community/?board=general;action=display;num=1105618881;start=0
> We just need to find the uwe secret compound that's in breast milk.
Ok, I'll take a stab. What about Lactoferrin?
Lactoferrin is an iron-binding protein that limits the availability of
iron to bacteria in the intestines, and alters which healthy bacteria
will thrive in the gut. Here's the LPS / Gut link again.
It is found in the highest concentrations in colostrum, but persists
throughout the entire first year. It has a direct antibiotic effect on
bacteria such as staphylococci and E. coli.
Get it while its hot: http://store.herbalnutricon.com/lacfe21011.html
Anyway, aren't you one step ahead Randall with your IP6 trial?
<snip>
Cruiser
-------------------------------------------------
http://www.thensome.com/flaxseedlinks.htm
Here is his excerpt on flaxseed oil and sulphur rich protein
Herbal Medicine, Healing & Cancer" by Donald Yance
"Flaxseed oil is rich in essential fatty acids, particularly ALA, which,
when taken in combination with sulfur-rich proteins, actually works to
create a new food. This was first discovered and made famous by Johanna
Budwig, a West German physician who had done a great deal of research on the
oil-protein combination. She discovered that EFAs need to bind to
sulfur-rich proteins (she used low-fat cottage cheese) before the body can
properly assimilate them. Budwig found that by feeding people with terminal
cancer this oil-protein combination, the yellowish-green substance in their
blood was replaced by the healthy red pigment, hemaglobin. The phosphatides
returned and the lipoproteins reappeared.
Of all the deficiencies that may exist in people with cancer, perhaps those
that are most important and totally ignored are EFAs, which, when taken with
protein, enhance our albumin levels. Albumin is a blood protein of immense
importance to good health. When flaxseed oil and sulfur-rich protein are
combined, the ALA and the EFAs in the flaxseed oil become water-soluble and
electron-rich; this causes the cell membrane to become more stable by making
it more flexible and fluidlike. The electron-rich fatty acids now allow for
efficient transport of materials and energy between the inner and outer cell
membrane. This is important to the health of all cells and to the entire
immune system.
A simple recipe for achieving these cellular benefits is to add 1 to 2
teaspoons of flaxseed oil or ground flaxseeds to 1 cup of organic yogurt
(preferabley goat or soy yogurt).
Omega-3 fatty acids are extremely important because they modulate
prostaglandins, which are very active biological substances important to
nearly every bodily function. They suppress tumor-promoting prostaglandin E2
by increasing prostiglandin E3 and suppressing AA. They also inhibit cancer
wasting. EPA and ALA, as well as other related omega-3 fatty acids, plus GLA
from evening primrose oil, have been found to kill a number of tumor-cell
lines and cause a significant reduction in tumor growth in animal studies."
(pp.219-220)
------------------------------------------------------
Cruiser
Cruiser
The intereting comment here is:
> Budwig found that by feeding people with terminal
> cancer this oil-protein combination, the yellowish-green substance in
their
> blood was replaced by the healthy red pigment, hemaglobin. The
phosphatides
> returned and the lipoproteins reappeared.
Phosphatides?
IP6?
Hayek also made a comment about a neck tumor, which was finally receiving
some real oxygenated blood.
Also, there was some comment about a doctor telling Hayek his therapy was
schoolboy stuff.
I know my kids studied the cell membrane in highschool.
I may just get out the low fat cottage cheese and pick up some flaxseed oil.
----------------------------------------------------------
http://home.online.no/~dusan/diseases/cancer/cancer_dr_budwig.html
Dr.Johanna Budwig Mix:
Put in your blender:
1 cup Organic cottage cheese (low fat, not too hard one, best make your
own)(or yogurt)
2-5 Tbsp. of flaxseeed oil-
1-3 Tbsp. of freshly ground up flaxseed (coffee grinder ($15) works fine)
enough water to make it soft
little cayenne
optional:
little garlic
little red pepper
little champagne
Make it very soft.
Eat some of it every day.
(PS Adjust quantities for your taste !)
------------------------------------------------------------
Cruiser
"Cruiser" <nospam.tg...@sympatico.ca> wrote in message
news:4D75f.19999$GH1.2...@news20.bellglobal.com...
randall
Pete wrote:
> randall wrote:
> http://www.psoriasis-help.org.uk/community/?board=general;action=display;num=1105618881;start=0
> > I used Vitamin C and IP6 many times over the years.
> >
> > marginally.
> >
> > Who knew the two to-gether would keep me clear for so long?
> >
> > And now with the D-glucarate and ????, it could be even better.
> >
> > At the BAC site, there must be dozens of things that cause a
> > rock hard... Well you get my drift.
>
> And here's another:
> http://www.psoriasis-help.org.uk/community/?board=general;action=display;num=1105618881;start=0
>
Poor AussieGuy! Bouncing around like a kangaroo with a stiffy. lol
Cut out his curry, stat!
He needs more surf.
I sent him the link to my surf spot cam. But i suppose his brand of
beer keeps him downunder? That and the stiffy pacifiers? lol
He does live in a beautiful place with good surf and nice weather.
> > We just need to find the uwe secret compound that's in breast milk.
>
> Ok, I'll take a stab. What about Lactoferrin?
>
Ok. Do psoriatics have to much or to little or are there other factors
at work?
If to little is it due to what? And is that the reason why a pagano
type diet works so well for some? Every time i went low iron
(vegetarian) i seemed to clear. But to really clear i had to take out
eggs and dairy and
i eventually would start to lose to much weight.
Is there a arachidonic acid and iron link in this thing?
And what about other things (non AA) in bovine milk?
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=pubmed&dopt=Abstract&list_uids=16190615
Sialic acid-containing milk proteins show differential immunomodulatory
activities independent of sialic acid.
Mikkelsen TL, Bakman S, Sorensen ES, Barkholt V, Frokiaer H.
BioCentrum-DTU, Biochemistry and Nutrition, Technical University of
Denmark, DK-2800 Kgs. Lyngby, Denmark.
The immunomodulatory activities of four sialic acid-containing milk
proteins (kappa-casein, glycomacropeptide, lactoferrin, and proteose
peptone-3 component) were determined, and the role of sialic acid was
evaluated. Two in vitro models were used: murine splenocyte
proliferation, where the effect on LPS-, Con A-, and PHA-stimulated
proliferation was studied, and cytokine production in LPS-stimulated
murine dendritic cells (DC). All four proteins inhibited LPS-induced
splenocyte proliferation, though to different degrees, and
independently of sialic acid. kappa-Casein strongly inhibited
PHA-induced proliferation and had a weak inhibitory effect on Con
A-induced proliferation, whereas lactoferrin stimulated Con A-induced
proliferation. kappa-Casein, glycomacropeptide, and lactoferrin
differentially affected cytokine production by DC: kappa-casein
significantly inhibited production of TNF-alpha, IL-10, -12, -6, and
-1beta, independent of sialic acid, whereas less-marked effects of
glycomacropeptide and lactoferrin were seen. These findings thus point
to important immunosuppressive effects of some milk proteins and
indicate that they may function via different mechanisms.
PMID: 16190615
Go to pubmed for 16 hits on P and sialic acid.
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=pubmed&dopt=Abstract&list_uids=8625974
Lymphocyte binding to vascular endothelium in inflamed skin revisited:
a central role for vascular adhesion protein-1 (VAP-1).
Arvilommi AM, Salmi M, Kalimo K, Jalkanen S.
National Public Health Institute, Finland. anna-maija...@utu.fi
The binding of leukocytes to vascular endothelium and their migration
into tissues is mediated by adhesion molecules on the endothelial cells
and leukocytes. Vascular adhesion protein-1 (VAP-1) is a 170-180/90-kDa
endothelial molecule expressed most prominently in high endothelial
venules in peripheral lymph node (PLN) type lymphatic tissues. VAP-1
mediates lymphocyte binding to PLN, tonsil and synovium. The expression
of VAP-1 is induced in inflammatory diseases such as arthritis and gut
inflammation. We examined the expression, structure and function of
VAP-1 in normal and inflamed skin and compared it to those of other
adhesion molecules implicated in skin homing. In psoriasis lichen ruber
planus, pemphigoid and allergic lesions, VAP-1 was markedly
upregulated. The expression of VAP-1 was also increased in biopsies of
healthy skin of the patients. The VAP-1 molecule induced in skin is
decorated with abundant sialic acids. VAP-1 inflamed skin is
functional, since inhibition with anti-VAP-1 monoclonal antibodies
caused a 60% reduction in lymphocytes adhesion to vascular endothelium.
Antibodies against E-selectin, which has been regarded as the major
vascular addressin directing cutaneous lymphocyte traffic, and,
surprisingly, against peripheral lymph node addressin (PNAd), caused
inhibitions of 30% and 60%, respectively, in the frozen section
adhesion assay. These findings suggest important roles also for VAP-1
and PNAd in lymphocyte homing into inflamed skin.
PMID: 8625974
> Lactoferrin is an iron-binding protein that limits the availability of
> iron to bacteria in the intestines, and alters which healthy bacteria
> will thrive in the gut. Here's the LPS / Gut link again.
>
Here's one,
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=pubmed&dopt=Abstract&list_uids=16209357
[Mechanisms and regulation of iron and heme utilization in
Gram-negative bacteria]
[Article in Polish]
Siudeja K, Olczak T.
Laboratory of Biochemistry, Institute of Biochemistry and Molecular
Biology, Wroclaw University, 2 Tamka St., 50-137 Wroclaw, Poland.
Iron and heme are essential nutrients for most pathogenic
microorganisms and play a pivotal role in microbial pathogenesis. To
survive within the iron-limited environment of the host, bacteria
utilize iron-siderophore complexes, iron-binding proteins (transferrin,
lactoferrin), free heme and heme bound to hemoproteins (hemoglobin,
haptoglobin, hemopexin). A mechanism of iron and heme transport depends
on the structures of Gram-negative bacterial membranes. ___(huh?)_____
Siderophores, hemophores and outer membrane receptors take part in iron
or heme binding. The transport of these ligands across the outer
membrane involves outer membrane receptors. The energy for this
transport is delivered from the inner membrane by a TonB-ExbB-ExbD
complex. The transport across the cytoplasmic membrane involves
periplasmic and inner membrane proteins comprising the ABC systems,
which utilize the energy derived from ATP hydrolysis. The major
regulatory role in iron homeostasis plays a Fur-Fe2+ repressor.
PMID: 16209357
Well, half of that went way over my head. But it looks suspicious
enough to try and learn what it means.
I've posted to many LPS posts in general. Revealing the structure seems
to be
the topic du jour for blocking the effects of sepsis. Especially during
surgery and recovery.
But for us. Blocking the Th1 skew, due to lps leakage, would certainly
take the fuel (tnf etc) away from creating psoriasis.
> It is found in the highest concentrations in colostrum, but persists
> throughout the entire first year. It has a direct antibiotic effect on
> bacteria such as staphylococci and E. coli.
>
> Get it while its hot: http://store.herbalnutricon.com/lacfe21011.html
Ok, but what if we don't need more absorbed iron? Will we end up with
excess hemoglobin? Is exercise the answer to that? Or should we bleed
ourselves once a month. lol
Or simply cut back on iron rich foods (meat)?
>
> Anyway, aren't you one step ahead Randall with your IP6 trial?
>
I guess. I'm eating more iron (meats) then I would have thought
possible without increasing psoriasis.
How are your trials doing?
randall.. does iron gut equal P? And does IP6 correct it?
randall
Cruiser wrote:
> Randall,
>
> The intereting comment here is:
>
> > Budwig found that by feeding people with terminal
> > cancer this oil-protein combination, the yellowish-green substance in
> their
> > blood was replaced by the healthy red pigment, hemaglobin. The
> phosphatides
> > returned and the lipoproteins reappeared.
>
> Phosphatides?
>
> IP6?
>
> Hayek also made a comment about a neck tumor, which was finally receiving
> some real oxygenated blood.
How would he know? It was
>
> Also, there was some comment about a doctor telling Hayek his therapy was
> schoolboy stuff.
>
> I know my kids studied the cell membrane in highschool.
>
> I may just get out the low fat cottage cheese and pick up some flaxseed oil.
>
> ----------------------------------------------------------
>
> http://home.online.no/~dusan/diseases/cancer/cancer_dr_budwig.html
> Dr.Johanna Budwig Mix:
My coPy of "Flax Oil As A True Aid Against Arthritis, Heart Infarction,
Cancer and other Diseases" was copyrighted in 1992. Her works go back
to 1953. And I recall the dairy (cottage cheese) seemed
counterintuitive
to clearing psoriasis. At least for me as dairy was right uP there in
the flare category.
So, i tossed out the dairy and kept the flax oil.
As to Dr. Budwig's solar energy cancer cure, i figured that
tanning was already well known as to a P TEMPORARY cure.
Once again, i'm confronted with dairy and why it flares me.
What's the magic flare in milk. Got milk? Got P and will it get
worse with milk?
Read the sialic acid cite in my post to Pete prior to this.
Dairy is also rich in arachidonic acid. Are psoriatics prone to
overreact
to that? You can google that in this group till you turn blue.
I doubt they had low-fat back then. At least when she first started.
If this is true, then there is a serious gap somewhere for psoriasis.
And that being psoriasis is the exception to the above. As i've
used this diet to zero results.
I do use the flax seed oil nearly everyday. And with IP6 and vitamin C,
i may be able to go back and use cottage cheese without flaring.
> > They also inhibit
> cancer
> > wasting. EPA and ALA, as well as other related omega-3 fatty acids, plus
> GLA
> > from evening primrose oil, have been found to kill a number of tumor-cell
> > lines and cause a significant reduction in tumor growth in animal
> studies."
> > (pp.219-220)
I would love to know what the figures are for late stage cancer
patients
on these protocols.
Just for grins.
As i know the promise delivers more then the facts as to P. :(
randall... keePing P more real by clearing it longer!
> >
> > ------------------------------------------------------
> >
> > Cruiser
> >
> >
Cruiser
I picked up some flax seed oil and some pantothenic acid 1000mg. I am going
to add these into the mix, with the low fat cottage cheese. I figure if
nothing else, I am getting a body tuneup.
Let's see what have I accomplished so far:
Correct a boron deficiency, turn over homecysteine to SAMe (to eliminate
elevated homocysteine), stock up on my body's vitamin reserves, top up my
RNA levels, detoxify my liver and body, top up glycogen, and now I am going
to, top up Coenzyme-A and repair cell membranes.
Cruiser
"randall" <ranh...@aol.com> wrote in message
news:1129658517.0...@f14g2000cwb.googlegroups.com...
Pete
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=3179202&dopt=Abstract
Plasma lactoferrin reflects neutrophil activation in psoriasis.
Kahler S, Christophers E, Schroder JM.
Department of Dermatology, Hautklinik University of Kiel, West Germany.
We used a biotinylated antibody ELISA technique to measure plasma levels
of lactoferrin (LF) and the LF content of peripheral blood PMN in 20
patients with psoriasis, 21 with eczema or other inflammatory skin
conditions, 19 patients with malignant skin tumours and 20 healthy
control individuals. In psoriasis, plasma LF levels were significantly
increased compared with levels in the other skin conditions and in the
healthy controls (P less than 0.01). Furthermore, in psoriasis the LF
content of circulating PMN was decreased. These findings provide further
evidence that in psoriasis systemic activation ('priming') of
circulating PMN may take place.
PMID: 3179202
-----------------------------------
Here's a connection with LPS...
http://www.pubmedcentral.gov/articlerender.fcgi?tool=pubmed&pubmedid=10024582
Neutralization of endotoxin in vitro and in vivo by a human
lactoferrin-derived peptide.
Zhang GH, Mann DM, Tsai CM.
Division of Bacterial Products, Center for Biologics Evaluation and
Research, Food and Drug Administration, Rockville, Maryland 20852,
USA.z...@usa.redcross.org
Endotoxin (lipopolysaccharide [LPS]) is the major pathogenic factor of
gram-negative septic shock, and endotoxin-induced death is associated
with the host overproduction of tumor necrosis factor alpha (TNF-alpha).
In the search for new antiendotoxin molecules, we studied the
endotoxin-neutralizing capacity of a human lactoferrin-derived 33-mer
synthetic peptide (GRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGP; designated LF-33)
representing the minimal sequence for lactoferrin binding to
glycosaminoglycans. LF-33 inhibited the coagulation of the Limulus
amebocyte lysate and the secretion of TNF-alpha by RAW 264.7 cells
induced by lipid A and four different endotoxins with a potency
comparable to that of polymyxin B. The first six residues at the N
terminus of LF-33 were critical for its antiendotoxin activity. The
endotoxin-neutralizing capacity of LF-33 and polymyxin B was attenuated
by human serum. Coinjection of Escherichia coli LPS (125 ng) with LF-33
(2.5 microg) dramatically reduced the lethality of LPS in the
galactosamine-sensitized mouse model. Significant protection of the mice
against the lethal LPS challenge was also observed when LF-33 (100
microg) was given intravenously after intraperitoneal injection of LPS.
Protection was correlated with a reduction in TNF-alpha levels in the
mouse serum. These results demonstrate the endotoxin-neutralizing
capability of LF-33 in vitro and in vivo and its potential use for the
treatment of endotoxin-induced septic shock.
PMID: 10024582
The full-text article is here:
http://www.pubmedcentral.gov/articlerender.fcgi?tool=pubmed&pubmedid=10024582
-----------------------------------
Here's an enlightening overview of Lactoferrin:
http://www.vitaminexpress.com/drmurray/drmurraynewsletter2004_02_14.htm
--
All the best,
Pete
------------------------------------------------
Home Page: http://users.bigpond.com/lansma
Location: 42°53'S; 147°19'E
randall
Pete wrote:
> This article reveals something amiss with Lactoferrin in psoriatics...
>
> http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=3179202&dopt=Abstract
>
> Plasma lactoferrin reflects neutrophil activation in psoriasis.
>
> Kahler S, Christophers E, Schroder JM.
>
> Department of Dermatology, Hautklinik University of Kiel, West Germany.
>
> We used a biotinylated antibody ELISA technique to measure plasma levels
> of lactoferrin (LF) and the LF content of peripheral blood PMN in 20
> patients with psoriasis, 21 with eczema or other inflammatory skin
> conditions, 19 patients with malignant skin tumours and 20 healthy
> control individuals. In psoriasis, plasma LF levels were significantly
> increased compared with levels in the other skin conditions and in the
> healthy controls (P less than 0.01). Furthermore, in psoriasis the LF
> content of circulating PMN was decreased. These findings provide further
> evidence that in psoriasis systemic activation ('priming') of
> circulating PMN may take place.
>
> PMID: 3179202
H'mmm, deja vu all over again,
http://groups.google.com/group/alt.support.skin-diseases.psoriasis/browse_frm/thread/6ecf870415c68c6e/9107799238b822bd?q=pmn&rnum=3#9107799238b822bd
Must have been the PMN,
http://groups.google.com/group/alt.support.skin-diseases.psoriasis/search?group=alt.support.skin-diseases.psoriasis&q=pmn&qt_g=1&searchnow=Search+this+group
I only read the P news thread for the obvious reason. :)
So IP6 must interact with caco-2 cells or some other gut deniZENS?
Thanks for helping me to clarify this Pete.
randall... its a jungle down there!
>
> -----------------------------------
>
> Here's a connection with LPS...
>
> http://www.pubmedcentral.gov/articlerender.fcgi?tool=pubmed&pubmedid=10024582
>
> Neutralization of endotoxin in vitro and in vivo by a human
> lactoferrin-derived peptide.
>
> Zhang GH, Mann DM, Tsai CM.
>
> Division of Bacterial Products, Center for Biologics Evaluation and
> Research, Food and Drug Administration, Rockville, Maryland 20852,
> USA.z...@usa.redcross.org
>
> Endotoxin (lipopolysaccharide [LPS]) is the major pathogenic factor of
> gram-negative septic shock, and endotoxin-induced death is associated
> with the host overproduction of tumor necrosis factor alpha (TNF-alpha).
> In the search for new antiendotoxin molecules, we studied the
> endotoxin-neutralizing capacity of a human lactoferrin-derived 33-mer
> synthetic peptide (GRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGP; designated LF-33)
Brings up the abegenix cite in the first link above.
cruiser
krebs cycle and are all depleted by stress, etc.
B2 riboflavin is used to make FAD, B3 niacinamide is used to make NAD, and
B5 pantothenic acid is used to make Coenzyme-A. Also used is Pi, which is
basically a phosphate group. The Krebs cycle involves a bunch of
phosphoralated compounds and some phosphate group exchanging. The rest
appears to be some aminos and some nuleotide related stuff; GTP - guanosine
triphosphate GDP - guanosine diphosphate
http://www.people.virginia.edu/~rjh9u/krebs.html
Here is a very good presentation on the liver detox methods of eliminating
waste and toxins from the body. It contains some really nice graphics.
http://www.homeopathicdoctor.ca/GSDL/App_Guides/Meta/ag_detox.pdf
Cruiser
Pete
> If to little is it due to what? And is that the reason why a pagano
> type diet works so well for some? Every time i went low iron
> (vegetarian) i seemed to clear. But to really clear i had to take out
> eggs and dairy and
> i eventually would start to lose to much weight.
I've been looking at the Pagano / Cayce approach. Although it is
ostensibly about consuming alkaline foods, the effect is that less
available iron is consumed.
The oxalates and phytates in the greens and cereals even reduce
absorption of iron as they bind with iron in the gut.
There's a lot of hype about the health benefits of low acid producing
foods but I wonder if this is at least partly about iron consumption for
psoriasis at least feeding the gram negatives?
Your IP6 points to this and perhaps also lactoferrin in breast milk
specifically to stop overgrowth of gram negs in infancy.
<exceptionally large snip>
--
randall
Pete wrote:
> <rather large snip>
>
> > If to little is it due to what? And is that the reason why a pagano
> > type diet works so well for some? Every time i went low iron
> > (vegetarian) i seemed to clear. But to really clear i had to take out
> > eggs and dairy and
> > i eventually would start to lose to much weight.
>
> I've been looking at the Pagano / Cayce approach. Although it is
> ostensibly about consuming alkaline foods, the effect is that less
> available iron is consumed.
That would be alkaline forming foods. Eating fruits like lemons, limes
and
oranges while full of acids forms the opposite.
>
> The oxalates and phytates in the greens and cereals even reduce
> absorption of iron as they bind with iron in the gut.
>
Maybe that's why i'm so tired this week? I ate two ip6 caps (one gram)
every other day and felt tired the next. Was going along fine and then
ran outa gas.
The only reason I took them was to see if the effects would clear it
even quicker. I am a clear junkie now. Oh my!
I firmly believe to get clearer now--- i'll have to change my diet.
That shouldn't be hard as I'm getting totally bored with meat twice a
day.
But if I get even worse *iron poor blood* i may have to cut back on
the ip6 to every other day (half a gram) and that means the Psoriasis
coming back.
How much is anyone's guess. I wish i could get J to come down from LA
to check me out.
I have the Fred Finkelstein psoriasis movie.
And i will be watching it soon! I have one friend whose next in line.
He's had fairly severe P for a majority of his life.
> There's a lot of hype about the health benefits of low acid producing
> foods but I wonder if this is at least partly about iron consumption for
> psoriasis at least feeding the gram negatives?
>
Yet, recall my logic when i started this trial. You were doing that
romanian (bartok) cleansing thing right? And i speculated that if i
took
a few grams of vitamin C to stimulate the digestive juices then less
food would reach the mucosal goo in the colon and thus make a
difference with psoriasis.
My intent was to stimulate bile and lower iron. And cheat the
the bad bugs in the colon. It's not like we will ever get rid of
them completely, but changing their diet was uPPermost in my mind.
> Your IP6 points to this and perhaps also lactoferrin in breast milk
> specifically to stop overgrowth of gram negs in infancy.
I took the colostrum products just prior to finding thewholewhey.com
triP. ZiPPo as to the big colostrum promises.
Nadda, nothing but a loss of greenbacks from the wallet. It may have
been close to a six month trial with it.
When I did thewholewhey.com thing it was night and day for the P.
It's existence was looking at the horizon.
And now in the last five years i've moved much closer to a complete
cure.
:)
Whats not to like?
A little segue,
My cat jumped in the grocery bag that was laying on the floor. She
didn't want to leave the celery behind. As she's an indoor cat those
greens she craves are harder to come by. So their she was rubbing
up against the celery leaves and refusing to get outa the bag.
Is this a metaphor for us? It's not like we had such a plenty of
meat foods till only recently. Prior to refrigeration it was consumed
in short order.
So are our P genes in response to iron absorption?
Heck i don't know. But Alan Menter and Ann Bowcock are zeroing in on
all the answers.
randall... going to pig out on chicken now!
>
> <exceptionally large snip>
Ouch!
Cruiser
>My cat jumped in the grocery bag that was laying on the floor. She
>didn't want to leave the celery behind. As she's an indoor cat those
>greens she craves are harder to come by. So their she was rubbing
>up against the celery leaves and refusing to get outa the bag.
I have a cat too. Maybe cats cause psoriasis! <LOL>
> So are our P genes in response to iron absorption?
> Heck i don't know. But Alan Menter and Ann Bowcock are zeroing in on
> all the answers.
I am thinking that UWE may have been tageting the mitochondrial oxygen
burning energy source.
The AIDS interview with Kremer starts out by talking about how mitochondrial
respiration and energy process gets messed up. The process gets skewed to
anaerobic energy production.
---------------------------------------------------------------------
http://www.virusmyth.net/aids/data/heinterviewhk.htm
The substances groups form nitrosothioles and nitrosamines and inhibit
fermentation activity in the respiratory organisms of our cells, the
mitochondria. The result is blockage of oxygen-dependent cell respiration.
The cells die or transfer to energy preparation typical of cancer cells
through fermentation independent of oxygen.
---------------------------------------------------------------------
UWE says at one point that he took care of the energy process and the rest
followed.
---------------------------------------------------------------------
A builder needs bricks and mortar to
build a wall, without them he is useless. And that is
what I do : supply the essentials for the energy
system of the body, and the immune system does the rest.
---------------------------------------------------------------------
That must mean aerobic energy, fat and oxygen to burn it.
He also said he figured this out, by looking for ways to repair his liver
after using antifungals.
---------------------------------------------------------------------
Actually, I found cause & cure for chronic fatigue by looking for a way
to help my liver recover from three years of Sporanox (anti fungal,
without sporanox, I reverted again to a cfs-zombie).
My method helps recover your liver completely and at the same time is an
excellent anti inflammant.
---------------------------------------------------------------------
I have been looking at the cross-section of mitochondrial aerobic energy and
liver repair.
Carnitine comes up.
http://www.smart-publications.com/articles/030203mitoplex.php
http://204.147.80.67/~brecovery/biochemical_repair_liver.html
Carnitine carries fatty acids into mitochondria for aerobic burn.
----------------------------------------------------------------------
http://www.invernessmedical.com/NSAminoAcids.cfm
Carnitine
The body is able to synthesize carnitine from the amino acids lysine and
methionine, which is why this amino acid is considered non-essential.
Carnitine is utilized in the complex process which releases energy from fat,
especially in the heart muscle.
-----------------------------------------------------------------------
http://vitaminlady.com/Articles/LCarn.art.asp
First, however, what it is. The prefix "L" would lead one to suppose that it
is an amino acid - but strictly speaking, although its structure is similar
to amino acids , it is more closely related to the B vitamins, and it plays
no role in protein structures. It is considered a nonessential nutrient in
the sense that the body can manufacture it from other nutrients present in
the body (Lysine, Methionine, B6 among others, with Vitamin C being a
limiting factor), but it is highly essential in its actions. In the diet it
is found mostly in muscle meats ( as the name would suggest, coming from the
Latin root for meat), and while it is rare for an actual clinical deficiency
to exist, sub-optimal levels can lead to many problems associated with
diabetes, obesity, cardiovascular disease and possibly Alzheimer and
muscular dystrophy.
The reason L-Carnitine can be involved in such a wide range of problems, and
the reason for its extreme importance in the maintenance of heart health, is
its influence on the destiny of the massive amounts of carbohydrates in the
average American diet. Excess carbs are stored as fat, and Carnitine
facilitates the burning of fat for energy by making it possible for the long
chain fatty acids it transports to enter the cell . After all, if the fatty
acids cannot reach the mitochondria where they are transformed to cellular
energy, it stands to reason they are going to be deposited in places where
the body will suffer from their presence, as happens in fatty liver disease,
fatty build-up in the heart, and your plain old everyday variety obesity,
where fatty build-up occurs in the muscles..
----------------------------------------------------------------------------
--------
http://www.rxlist.com/rxboard/lipitor.pl?noframes;read=4118
The article states there are no cures for mitochondrial disease. listed on
page 640 of the article are the vitamins, supplements, and medications used
in mitochondrial diseases: coq10, L-carnitine, B1, B2, B3, Folate, Vit E,
Selenium, Lipoic Acid and one medication: Prednisone. The article concludes
that "antioxidant use makes sense on theoretical grounds. Free radicals,
which damage lipid membranes such as the inner mitochondrial membrane, are
overproduced in disorders of mitochondrial function and may be scavenged by
antioxidants". I find it more than interesting that Statins dismantle the
body's own manufacturing of a major antioxidant and think that after a
period of time, mitochondrial malfunction occurs because free radicals that
are not neutralized damage the cell itself! the web site for this article
is: http://www.ccjm.org/pdffiles/Cohen701.PDF
--------------------------------------------------------
http://www.wjgnet.com/1007-9327/5/312.asp
Many factors contribute to the development of TPN-associated hepatic
steatosis. Absolute or relative deficiency of carnitine is an important
factor. Long-term TPN can lead to a reduced level of carnitine, and chronic
liver disease itself can also cause deficiency of carnitine. Rudman et
al[9]determined s erum carnitine level in 273 hospitalized patients and 12
normal subjects, and fo und that serum carnitine level in cirrhotic patients
was only 25% of that in non -cirrhotic patients as well as in normal
subjects; and autopsy study revealed t hat the content of carnitine in
liver, kidney, muscle and brain of cirrhotics w as only 1/3 to 1/4 that of
noncirrhotic patients.
Carnitine plays an important role in ?-oxidation of free fatty acid
and tricarboxylic acid cycle in mitochondria. In a carnitine deficiency,
?-oxidation of free fatty acids would be inhibited, which leads to the liqid
infiltration of hepatocytes as well as the insufficient production of ATP
and consequent liver failure. Supplementation of carnitine probably can help
prevent the TPN-associated hepatic steatosis, and promote oxidation of fat
and recovery of liver function. The present study demonstrated that
carnitine supplementation could minimize TPN-associated hepatic steatosis in
both normal and cirrhotic rats. In addition, g roup C2 tended to have a
lower ALT and higher ALB in comparison with group B2. I t suggested that
carnitine supplementation during TPN was helpful in reducing th e severity
of hepatic steatosis and subsequently protecting liver function. It i s
reasonable to speculate that carnitine supplementation in long term TPN is
of therapeutic value, particularly for patients with impaired liver
function. Furt her studies are still, however, needed to fully evaluate its
clinical usefulness .
Cruiser
Cruiser
http://www.pdrhealth.com/drug_info/nmdrugprofiles/nutsupdrugs/lca_0060.shtml
Investigation of L-carnitine may have some positive impact on some immune
disorders, including AIDS. In a study of 20 patients with advanced AIDS,
subjects were randomly assigned to receive either placebo or 6 grams of
L-carnitine daily. At baseline, L-carnitine concentrations in the peripheral
blood mononuclear cells (PBMC) of the AIDS patients were found to be lower
than in healthy controls, even though the AIDS patients had normal serum
concentrations of L-carnitine.
The study continued for two weeks. It demonstrated a significant trend
toward restoration of normal intracellular L-carnitine levels. This increase
in cellular L-carnitine was strongly associated with improved lymphocyte
proliferative responsiveness to mitogens. The researchers suggested that
"L-carnitine supplementation could have a role as a complementary therapy
for HIV-infected individuals." The study also noted a significant decrease
in the triglyceride levels of those patients receiving L-carnitine
supplements. More research is clearly warranted.
Cruiser
manf...@lycos.com
Cruiser wrote:
>
> I have been looking at the cross-section of mitochondrial aerobic energy and
> liver repair.
>
> Carnitine comes up.
>
And for those rock hard erections-----
Carnitine or Testosterone
for Older Men?
Carnitine compares favorably with
testosterone in the treatment of sexual
dysfunction, depression, and fatigue in
older men, say researchers from Italy.
For six months, one group of patients
was given testosterone undecanoate 160
mg/day; a second group received
propionyl-L-carnitine 2 g/day plus acetyl-
L-carnitine 2 g/day; and a third group
was given placebo. Testosterone and carnitines
both significantly improved erectile
function, depression, and fatigue.
Testosterone significantly increased
prostate volume and free and total testosterone
levels and significantly lowered
serum luteinizing hormone, whereas
carnitines did not. Both testosterone and
carnitines were effective for only as long
as they were administered. Stopping
them reversed all values to baseline levels,
except for prostate volume in the first
group; these levels remained significantly
greater than baseline six months
after testosterone was stopped.
Several aging mechanisms share an
increase in reactive oxygen species,
membrane damage, and cell death. Carnitines
act against diseases typical of
aging, such as intermittent claudication
and Alzheimer's disease, because of their
antioxidant effects.
The researchers suggest that carnitines
might help to prevent at least one
side effect of testosterone administration-
prostate enlargement.
(Source: Urology 2004;63:641-646.)
Cruiser
When I last had blood work done, my triglycerides where elevated.
I picked up som carnitine and some Alpha-lipoic-Acid to try over the
weekend.
The carnitine is very expensive, so I can't use it for long.
When it runs out, I will just take lysine with NAC.
> Both testosterone and
> carnitines were effective for only as long
> as they were administered. Stopping
> them reversed all values to baseline levels,
Uwe claimed the erection thing as a possible side effect of taking his
supplements. He never claimed it would last.
However, if general health is restored, then healthy sexual performance may
be an expected result. He did mention that.
Cruiser
Cruiser
http://www.vrp.com/art/912.asp
It has some cool graphics.
Cruiser
randall
If something's wrong with the amino acids i'm sure you've already
covered all the bases more or less. If there was a need for some
non essential amino acid we'd know due to the pathways that are
already known. The same would be true for ratio's between the
essential ones.
http://www.people.virginia.edu/~rjh9u/aminacid.html
As to my feelings about whether uwe found something lacking,
is driven by his admission in several of his posts that you needed
to correct the diet. Ergo something is lacking due to too much
of something else in his paradigm.
If you have a genetic anomaly that causes the *lack* or
it's due to diet is easily provable as far as i've done it many times.
I can and have gone on the vegetarian diet that cuts out all omega-6
fats and cleared nicely. So is arachidonic acid (AA) an amino acid?
No.
Diet can correct psoriasis. Cutting out all foods with omega-6
FA's seems to do the trick. Thus this is a prime P pathway.
http://www.ncbi.nlm.nih.gov/entrez/dispomim.cgi?id=603700
As to finding the correct ratio of one Amino acid to another, if
predicated upon inflammatory factors, then is dependent upon
stats in the very mucosal grounds that i have expounded upon for
nearly five years now.
http://www.ncbi.nlm.nih.gov/entrez/dispomim.cgi?id=102582
(..)
Using immunohistochemical analysis, Sano et al. (2005) demonstrated
activated STAT3 in epidermal keratinocytes from human psoriatic lesions
(see 177900). Transgenic mice with keratinocytes expressing a
constitutively active Stat3 developed skin lesions, either
spontaneously or in response to wounding, that closely resembled human
psoriatic plaques; in transgenic keratinocytes there was upregulation
of several molecules linked to the pathogenesis of psoriasis. The
development of psoriatic lesions in the transgenic mice required
cooperation between Stat3 activation in keratinocytes and activated T
cells, and abrogation of Stat3 function by a decoy oligonucleotide
inhibited the onset and reversed established psoriatic lesions <sniP>
(This passage is found half way down the page, just prior to the
references.)
But if you wish to further put to-gether trials to find some amino acid
cocktail, then, you best try to understand the complexity that awaits
you.
http://www.nature.com/nrm/journal/v6/n11/full/nrm1761_fs.html
I find it easier to decide on possible P etiologies and affect prime
pathways from trials that take those factors into consideration.
Thusly i continue my current trials.
randall...
manf...@lycos.com
psoriasis? Most of this stuff is way over my head!
A new therapeutic approach to treat psoriasis by inhibition of fatty
acid oxidation by Etomoxir.
Caspary F, Elliott G, Nave BT, Verzaal P, Rohrbach M, Das PK,
Nagelkerken L, Nieland JD.
Derphartox, PO Box 609, 2600 AP Delft, the Netherlands.
Background The dogma in psoriasis is that due to pathogen-induced
inflammatory responses, an autoreactive immune response is induced that
leads to tissue destruction. However, this model might be too
simplistic. Literature data suggest that the expression of enzymes
crucial for fatty acid oxidation is upregulated in the skin of patients
with psoriasis compared with healthy individuals. Objectives To examine
the influence of fatty acid oxidation on psoriasis with regard to
expression and activity of the key enzyme in fatty acid oxidation,
carnitine palmitoyltransferase-1 (CPT-1) and the effect of the CPT-1
inhibitor, Etomoxir. Methods Experiments were performed with
homogenates of lesional and healthy skin, fibroblast cultures and a
model of human psoriatic skin transplanted on immune-deficient BNX
mice. Results CPT-1 was highly active in lesional skin. Etomoxir was
able to block CPT-1 activity in skin, implying that this antagonist may
have the potential to suppress psoriasis when administered topically.
In the mouse model, Etomoxir had an antipsoriatic effect that was at
least as good as that of betamethasone, as evidenced by reduction of
epidermal thickness, keratinocyte proliferation and differentiation.
Conclusions We conclude that fatty acid metabolism and in particular
CPT-1 may be an excellent target for treatment of psoriasis.
PMID: 16225603 [PubMed - in process]
cruiser
FWIW, there was one page where it said that carnitine is more properly
related to the B vitamins, rather than an amino acid.
It comes in red meats, and the body can make it from cysteine and lysine,
but that requires some cofactors, and cysteine can be in short supply.
The ability of the body to manufacture it, can be impaired by liver damage.
Cruiser
"randall" <ranh...@aol.com> wrote in message
news:1131217277.7...@o13g2000cwo.googlegroups.com...
cruiser
FWIW, there was one page where it said that carnitine is more properly
related to the B vitamins, rather than an amino acid.
It comes in red meats, and the body can make it from cysteine and lysine,
but that requires some cofactors, and cysteine can be in short supply.
The ability of the body to manufacture it, can be impaired by liver damage.
Cruiser
"randall" <ranh...@aol.com> wrote in message
news:1131217277.7...@o13g2000cwo.googlegroups.com...
JXStern
>Can you guys tell me--according to this, is Carnitine good or bad for
>psoriasis? Most of this stuff is way over my head!
>
>A new therapeutic approach to treat psoriasis by inhibition of fatty
>acid oxidation by Etomoxir.
http://www.biochemj.org/bj/351/bj3510495.htm
Rat peroxisomal carnitine octanoyltransferase (COT), which facilitates
the transport of medium-chain fatty acids through the peroxisomal
membrane, is irreversibly inhibited by the hypoglycaemia-inducing drug
etomoxir.
http://www.biochemj.org/bj/351/bj3510495.htm
The effects of etomoxir, an inhibitor of mitochondrial long-chain
fatty acid oxidation ...
--
Carnitine, I dunno, but what's all this about etomoxir?
Do we want to be hypoglycaemia-induced?
Is that what happens when you fast for 24 hours?
Hmmmm, ...
J.
randall
manf...@lycos.com wrote:
> Can you guys tell me--according to this, is Carnitine good or bad for
> psoriasis? Most of this stuff is way over my head!
Then lets make it simple.
Can you eat less meat and relieve your psoriasis some?
If so, then your like the 1000's of folks who can do the pagano
diet or simply go vegetarian and clear up some or a lot.
I would do extremely well as a vegetarian as far as my skin is
concerned.
So, is it the carnitine amino acids in all that meat or is it AA? Or
both
for that matter?
Lets go on.
>
>
>
> A new therapeutic approach to treat psoriasis by inhibition of fatty
> acid oxidation by Etomoxir.
This is 42 hits back in a search of psoriasis. So, i'm surprised i
missed it.
Good find and thank you for bringing it uP.
It may show why we (or most of us anyway) clear up by eating less
foods containing arachidonic acids.
Lets dig up the dirt on etomoxir. The first thing i found was the use
for
heart patients.
Where does etomoxir come from?
http://www.arkat-usa.org/ark/journal/2004/I10_Rickards/RI-1130C/RI-1130C.asp
Not much in the groups,
http://groups.google.com/groups?q=Etomoxir.&qt_s=Search&tab=ng&ie=UTF-8&sa=N
Now we already know the PPARs are in the P pathways from pubmed and our
own musings.
http://groups.google.com/group/alt.support.skin-diseases.psoriasis/search?group=alt.support.skin-diseases.psoriasis&q=ppar&qt_g=1&searchnow=Search+this+group
So with cpt-1, we have a thyroid and PPAR P connection.
A trifecta of sorts.
Lets look at the science closer.
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=pubmed&dopt=Abstract&list_uids=15469941
Peroxisomal proliferator-activated receptor-gamma coactivator-1 alpha
(PGC-1 alpha) enhances the thyroid hormone induction of carnitine
palmitoyltransferase I (CPT-I alpha).
Zhang Y, Ma K, Song S, Elam MB, Cook GA, Park EA.
Department of Pharmacology, College of Medicine, University of
Tennessee Health Science Center, Memphis, Tennessee 38163, USA.
Carnitine palmitoyltransferase I (CPT-I) catalyzes the rate-controlling
step in the pathway of mitochondrial fatty acid oxidation. Thyroid
hormone will stimulate the expression of the liver isoform of CPT-I
(CPT-I alpha). This induction of CPT-I alpha gene expression requires
the thyroid hormone response element in the promoter and sequences
within the first intron. The peroxisomal proliferator-activated
receptor-gamma coactivator-1 alpha (PGC-1 alpha) is a coactivator that
promotes mitochondrial biogenesis, mitochondrial fatty acid oxidation,
and hepatic gluconeogenesis. In addition, PGC-1 alpha will stimulate
the expression of CPT-I alpha in primary rat hepatocytes. Here we
report that thyroid hormone will increase PGC-1 alpha mRNA and protein
levels in rat hepatocytes. In addition, overexpression of PGC-1 alpha
will enhance the thyroid hormone induction of CPT-I alpha indicating
that PGC-1 alpha is a coactivator for thyroid hormone. By using
chromatin immunoprecipitation assays, we show that PGC-1 alpha is
associated with both the thyroid hormone response element in the CPT-I
alpha gene promoter and the first intron of the CPT-I alpha gene. Our
data demonstrate that PGC-1 alpha participates in the stimulation of
CPT-I alpha gene expression by thyroid hormone and suggest that PGC-1
alpha is a coactivator for thyroid hormone.
PMID: 15469941
http://www.google.com/search?ie=UTF-8&q=cpt-1+thyroid&qt_s=Search&tab=nw&sa=N
http://www.fasebj.org/cgi/content/full/16/12/1688
Etomoxir, sodium 2-[6-(4-chlorophenoxy)hexyl] oxirane-2-carboxylate,
inhibits triacylglycerol depletion in hepatocytes and lipolysis in
adipocytes.
Spurway TD, Pogson CI, Sherratt HS, Agius L.
Department of Medicine, University of Newcastle upon Tyne, UK.
The effects of etomoxir, an inhibitor of mitochondrial long-chain fatty
acid oxidation, on triacylglycerol metabolism in rat hepatocytes and
adipocytes were investigated. Etomoxir inhibited the depletion of
triacylglycerol stores in hepatocytes incubated without exogenous fatty
acids and inhibited lipolysis in adipocytes. The effects on hepatocytes
could be attributed to two mechanisms. At low concentrations (1-10
microM) R-etomoxir increased fatty acid esterification by inhibition of
beta-oxidation. This effect was specific for the R-enantiomer and was
associated with increased triacylglycerol secretion. At higher
concentrations (50-100 microM) RS-etomoxir inhibited lipolysis and
triacylglycerol secretion, independently of inhibition of carnitine
palmitoyl-transferase I. These effects of RS-etomoxir on
triacylglycerol metabolism and lipolysis may contribute to the chronic
hypolipidaemic effects of etomoxir in vivo.
PMID: 9074648
NOw i'm wondering if any heart attack people have cleared their
psoriasis while
taking etomoxir? Any nurses out there with their eyes open?
Sudden pain in cheat!
I'm feeling like my heart is missing a beat.
Oh ouch. Heart needs some etomoxir!
I'll let you know if i live or die.
Or my skin clears a few percent or not. lol
randall... did your heart skiP a beat too?
manf...@lycos.com
Acta Vitaminol Enzymol. 1967;21(5):168-78. Related Articles, Links
[Therapeutic experiments with antimetabolites of folic acid in the cure
of psoriasis]
[Article in Italian]
Caccialanza P.
PMID: 5241417 [PubMed - indexed for MEDLINE]
randall
The simple answer is
No. This far back you'd have to go to a medical library at some
University
in your area. Even then you might not find it.
You could use the pinch site to look at patents for psoriasis and folic
acid?
If you wish to see the muddy mud skiPPer who started this group, try
pinch.com.
>
> Acta Vitaminol Enzymol. 1967;21(5):168-78. Related Articles, Links
>
>
> [Therapeutic experiments with antimetabolites of folic acid in the cure
> of psoriasis]
>
> [Article in Italian]
>
> Caccialanza P.
You can try an author search,
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=pubmed&cmd=Search&term=%22Caccialanza+P%22%5BAuthor%5D
And as you see most of these don't have abstracts.
Why not do a folic acid + P search on the web? Add in keyword database
to
filter out the noise.
http://www.google.com/search?hl=en&lr=&q=folic+acid+psoriasis+database&btnG=Search
As your lost abstract was from 1967, you no doubt have more uP to date
info in this
search anyway.
randall...
manf...@lycos.com
I have been trying to track down the "unspecified amount of vitamin C"
used in this study. But even this is from 1977 so I would think we
would have heard more about it by now. Just thought it might be an
ingredient in Haye's so called cure.
Folic acid antagonist drugs have been used to treat psoriasis. In one
preliminary report, extremely high amounts of folic acid (20 mg taken
four times per day), combined with an unspecified amount of vitamin C,
led to significant improvement within three to six months in people
with psoriasis who had not been taking folic acid antagonists;those who
had previously taken these drugs saw a worsening of their condition.
randall
manf...@lycos.com wrote:
> Thanks Randall
> I have been trying to track down the "unspecified amount of vitamin C"
> used in this study.
Brilliant!
> But even this is from 1977 so I would think we
> would have heard more about it by now. Just thought it might be an
> ingredient in Haye's so called cure.
Uwe Hayek said anything about vitamin C?
I'll do the search now.
Hey! I was enjoying this LPi hit,
http://lpi.oregonstate.edu/infocenter/vitamins/fa/
from the folic acid search and forgot uwe's
hero's. H'mmm looks mostly anecdotal, einstein and pauling. lol
He says the same thing in most of the posts except for the thread
called
"something practical" where he says vitamin C is more dangerous then.
Well look for yourself.
*******
"I think it is about as safe as a "nutraceutical" can
get. Vitamin C is more dangerous.
Doing nothing about your nutritional deficiency is
actually more dangerous. Not only for you but also
for your children. If you do not have enough of
these nutrients, your breast milk also lacks them.
And these nutrients are extremely important for life
that develops. I gave them to a completely starved
stray kitten that I adopted, and now it's supercat.
Muscular, energetic, bright and shiny fur."
*****************
There you have it. He's Tom Jones singing the whats new pussy cat song.
http://www.cnn.com/interactive/world/0206/jubilee.gallery.weekend/tom.jones.jpg
Good old Tom must be taking the stuff as well? lol
But how well did it work for the audience?
http://www.google.com/search?hl=en&q=tom+jones+codpiece&spell=1
I don't think his JONES lives UP to the hyPe! <G>
It ain't a uwe cure.
He faked the piPe. lol
My Pussy cat will have to remain non supercat. ;-/
Good thing she's not a TOM.
>
>
> Folic acid antagonist drugs have been used to treat psoriasis. In one
> preliminary report, extremely high amounts of folic acid (20 mg taken
> four times per day), combined with an unspecified amount of vitamin C,
Left uP to Linus and this would be around 10-20 grams a day. He did
live till 93 and worked,
http://lpi.oregonstate.edu/lpbio/lpbio2.html
I wonder if i can find his daily suPPlement regime?
That search brought up SB,
http://www.quackwatch.org/01QuackeryRelatedTopics/pauling.html
& that take you here,
http://www.quackwatch.org/01QuackeryRelatedTopics/Cancer/c.html
I'll try again,
http://vitamincfoundation.org/page2.html#PAULING
Darn most of the links aren't working for me.
One says something about taking 18 grams.
Oh well.
My little C&IP6 trial is working and i'm still trying to figure out
why.
I may enlist more then the few folks who are now fooling around
with it.
randall... I C clear SKIN where once plaques resided..